DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5945 and CG14259

Sequence 1:NP_001260439.1 Gene:CG5945 FlyBaseID:FBgn0032494 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_651532.1 Gene:CG14259 FlyBaseID:FBgn0039483 Length:289 Species:Drosophila melanogaster

Alignment Length:264 Identity:57/265 (22%)
Similarity:120/265 (45%) Gaps:27/265 (10%)


  Fly     6 GLLSLLALGCSAAPTDKN------YFAD----LPKCSTEEDQLGECVKQLFNTLTPRLKDGNPEL 60
            |||::|.|  :....|::      |:::    ||.|...|....:|.......|..:|..|.||:
  Fly    16 GLLAILCL--NEIAMDRSLVSAVAYYSEKPAFLPSCRIYEPGFTKCSTNSIQKLLDQLNIGIPEV 78

  Fly    61 --RIEPYEPLHLNRTSFQYSS---GTVNGRITVRNAKIYGFSSNRAKE--VSVKLNGDKVKLRLV 118
              |..|::|:.:....|:..:   .|:...:|  :..:.||::.:.||  ||.|....:.|:.| 
  Fly    79 LERFGPFDPMRVRDIVFKQDNNEVATIRANLT--DLVVKGFANTKVKESRVSKKDFSWQTKIYL- 140

  Fly   119 TQMPKLNIVGSYKADMQVNQLQLKPKGEFNVTLLDVEAITVTDGEVYEKDGHRFFRLKNIDSKPK 183
               ||:.:.|.|:...::..:.|...|:..:.:.|::.:.:|...:|||.|..|..:..:..:..
  Fly   141 ---PKMRLDGRYEMAGRILLIPLSGSGKIFIEIDDLDILLLTKIRLYEKGGFTFDNVTAVQVQLN 202

  Fly   184 IKDLVIKANGIF--ADPELDKIALNVANQYWRDIYGIMLPETRQFWQPLMLRMFNEAFELVPIDQ 246
            :..:....:.:|  ...|:::......|:.|||.|..:.|...:..:.::..:.:..|.|:|.:.
  Fly   203 LSKVRTYLDNLFNGRSKEVERSTNEFFNENWRDFYEALKPLIVETVENILYDVMSTVFHLIPANF 267

  Fly   247 FLKE 250
            |:::
  Fly   268 FVED 271

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5945NP_001260439.1 JHBP 22..249 CDD:214779 51/246 (21%)
CG14259NP_651532.1 JHBP 32..269 CDD:284096 51/243 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1403840
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.