DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5945 and CG14661

Sequence 1:NP_001260439.1 Gene:CG5945 FlyBaseID:FBgn0032494 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001246918.1 Gene:CG14661 FlyBaseID:FBgn0037288 Length:246 Species:Drosophila melanogaster

Alignment Length:210 Identity:48/211 (23%)
Similarity:83/211 (39%) Gaps:41/211 (19%)


  Fly     5 IGLLSLLALGCSAAPTDKNYFADLPKCSTEEDQLGECVKQLFNTLTPRLKDGNPELRIEPYEPLH 69
            :..|.:..:.|.:|....:|   :..|...:.:|.:|:|...:.|.|.|..|..||.:.|.|||:
  Fly     7 VASLLICFVACISAGNMPDY---IQVCHRNDPELSKCLKSSVHNLRPYLAKGIKELNVPPLEPLY 68

  Fly    70 LNRTSFQYSSGTVNGRITVRNAKIYGFSSNRAKEVSVKLNGDKVKLRLVTQ---------MPKLN 125
            :...|.  ..|:....:..:...|.|.|           |.:..|||..||         :|.|:
  Fly    69 IGDLSI--LDGSAGLTVKAKKLNILGAS-----------NFEITKLRASTQNRRFDFELILPHLH 120

  Fly   126 IVGSYKADMQVNQLQLKPKGEF--NVT--------------LLDVEAITVTDGEVYEKDGHRFFR 174
            ..|.|:.:..:..|.:|..|.|  |.|              :.|:|.:.|.:..:..:.|....:
  Fly   121 GDGLYEINGNILALPIKGNGPFTGNFTNFVAYVRVQYDIKSVNDLEYLHVKEFVLKIRTGKGNLK 185

  Fly   175 LKNIDSKPKIKDLVI 189
            |:|:.:..|:...||
  Fly   186 LENLFNGDKVLGDVI 200

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5945NP_001260439.1 JHBP 22..249 CDD:214779 45/194 (23%)
CG14661NP_001246918.1 JHBP 10..245 CDD:284096 48/208 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1403711
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.