DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5945 and CG5867

Sequence 1:NP_001260439.1 Gene:CG5945 FlyBaseID:FBgn0032494 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_609625.2 Gene:CG5867 FlyBaseID:FBgn0027586 Length:262 Species:Drosophila melanogaster

Alignment Length:254 Identity:93/255 (36%)
Similarity:154/255 (60%) Gaps:11/255 (4%)


  Fly     6 GLLSLLALG--CSAAPTD---------KNYFADLPKCSTEEDQLGECVKQLFNTLTPRLKDGNPE 59
            |:::|:.:.  |.||..:         :....|:|.|...:..:.||:||....:|||:|.|..|
  Fly     6 GVVALILMAGLCLAAEIELPPVEFKPVREIPGDIPTCREGDINISECIKQGLQQITPRMKYGISE 70

  Fly    60 LRIEPYEPLHLNRTSFQYSSGTVNGRITVRNAKIYGFSSNRAKEVSVKLNGDKVKLRLVTQMPKL 124
            |.|.|.:|..:.::|:.|:||.:.|||:::|..|:|.|.....:|:.:|...:|::.:::.:|::
  Fly    71 LNIPPLDPFEMGKSSYSYTSGLLQGRISMKNVVIHGLSEGIVDKVNFRLKDGRVRMEILSHVPQM 135

  Fly   125 NIVGSYKADMQVNQLQLKPKGEFNVTLLDVEAITVTDGEVYEKDGHRFFRLKNIDSKPKIKDLVI 189
            .:.|.||||:::|.|:|.|||.||:|:.||.......||:||:|||.:.||..::::||:.||..
  Fly   136 FVEGLYKADIKLNDLKLNPKGAFNITMTDVAMRARPIGELYERDGHTYLRLTKLETEPKVGDLKF 200

  Fly   190 KANGIFADPELDKIALNVANQYWRDIYGIMLPETRQFWQPLMLRMFNEAFELVPIDQFL 248
            .|||:..||.|:.:.|:..|||||.:|..|||||...||||:|:..|:.|..:|.|..:
  Fly   201 YANGLVPDPVLNDVILDFINQYWRQLYQAMLPETLDTWQPLILKSTNDFFAALPFDMLV 259

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5945NP_001260439.1 JHBP 22..249 CDD:214779 88/228 (39%)
CG5867NP_609625.2 JHBP 34..260 CDD:214779 88/227 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1402641
eggNOG 1 0.900 E1_2DDPC
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.