DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5867 and CG17189

Sequence 1:NP_609625.2 Gene:CG5867 FlyBaseID:FBgn0027586 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001356927.1 Gene:CG17189 FlyBaseID:FBgn0039485 Length:271 Species:Drosophila melanogaster

Alignment Length:267 Identity:60/268 (22%)
Similarity:116/268 (43%) Gaps:38/268 (14%)


  Fly    10 LILMAGL----CLAAEIELPPVEFKPVREIPGDIPTCREGDINISECIKQGLQQITPRMKYGISE 70
            ::|.|||    |:|...|.|..           |.:|:..:...::|..:.:|....::..|:.|
  Fly     8 MLLHAGLQGAQCVAFYTEKPSY-----------IESCKIYEPEFTKCSTRSIQAFMNQLVKGVPE 61

  Fly    71 L--NIPPLDP-------FEMGKSSYSYTSGLLQGRISMKNVVIHGLSEGIVDKVNFRLKDGRVRM 126
            :  :..|:||       |:...|..:..|.      ::.:::|.|..:.::.:.....||.....
  Fly    62 IEESFGPIDPMRQEQLVFKQDNSDVATLSA------NLTDMLIRGFGKMLIKESKVSKKDFSWLT 120

  Fly   127 EILSHVPQMFVEGLYK--ADIKLNDLKLNPKGAFNITMTDVAMRARPIGELYERDGHTYLRLTKL 189
            :|  ::|||.::|.||  ..|.|..|:.|.|....|...|:.|..:.  .|||:.|:|:..:|.:
  Fly   121 KI--YLPQMRIDGHYKMVGRILLVPLQGNGKIVMEIDDLDILMTTKT--RLYEKGGYTFYNVTSV 181

  Fly   190 ETEPKVGDLKFYANGLV--PDPVLNDVILDFINQYWRQLYQAMLPETLDTWQPLILKSTNDFFAA 252
            :.:..||.::...:.|.  ....:.|....|.|..|:.:::|:.|..::|.:..:|...:..||.
  Fly   182 KVKVDVGKVRTRLDNLFNGHSKEVEDSTNQFFNDNWKDVFEALRPLVVETVERTLLDLLHKTFAL 246

  Fly   253 LPFDMLV 259
            .|....|
  Fly   247 FPASFFV 253

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5867NP_609625.2 JHBP 34..260 CDD:214779 52/240 (22%)
CG17189NP_001356927.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1405243
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.