DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5867 and CG14259

Sequence 1:NP_609625.2 Gene:CG5867 FlyBaseID:FBgn0027586 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_651532.1 Gene:CG14259 FlyBaseID:FBgn0039483 Length:289 Species:Drosophila melanogaster

Alignment Length:261 Identity:56/262 (21%)
Similarity:119/262 (45%) Gaps:21/262 (8%)


  Fly    12 LMAGLCLAAEIELPPVEFKPV---REIPGDIPTCREGDINISECIKQGLQQITPRMKYGISEL-- 71
            |:|.||| .||.:.......|   .|.|..:|:||..:...::|....:|::..::..||.|:  
  Fly    17 LLAILCL-NEIAMDRSLVSAVAYYSEKPAFLPSCRIYEPGFTKCSTNSIQKLLDQLNIGIPEVLE 80

  Fly    72 NIPPLDPFEMGKSSYSYTSG-LLQGRISMKNVVIHGLSEGIVDKVNFRLKDGRVRMEILS----- 130
            ...|.||..:....:...:. :...|.::.::|:.|.:       |.::|:.||..:..|     
  Fly    81 RFGPFDPMRVRDIVFKQDNNEVATIRANLTDLVVKGFA-------NTKVKESRVSKKDFSWQTKI 138

  Fly   131 HVPQMFVEGLYKADIKLNDLKLNPKGAFNITMTDVAMRARPIGELYERDGHTYLRLTKLETEPKV 195
            ::|:|.::|.|:...::..:.|:..|...|.:.|:.:.......|||:.|.|:..:|.::.:..:
  Fly   139 YLPKMRLDGRYEMAGRILLIPLSGSGKIFIEIDDLDILLLTKIRLYEKGGFTFDNVTAVQVQLNL 203

  Fly   196 GDLKFYANGLV--PDPVLNDVILDFINQYWRQLYQAMLPETLDTWQPLILKSTNDFFAALPFDML 258
            ..::.|.:.|.  ....:.....:|.|:.||..|:|:.|..::|.:.::....:..|..:|.:..
  Fly   204 SKVRTYLDNLFNGRSKEVERSTNEFFNENWRDFYEALKPLIVETVENILYDVMSTVFHLIPANFF 268

  Fly   259 V 259
            |
  Fly   269 V 269

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5867NP_609625.2 JHBP 34..260 CDD:214779 48/237 (20%)
CG14259NP_651532.1 JHBP 32..269 CDD:284096 48/244 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1405273
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.