DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5867 and to

Sequence 1:NP_609625.2 Gene:CG5867 FlyBaseID:FBgn0027586 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001287525.1 Gene:to FlyBaseID:FBgn0039298 Length:249 Species:Drosophila melanogaster

Alignment Length:263 Identity:59/264 (22%)
Similarity:102/264 (39%) Gaps:40/264 (15%)


  Fly     9 ALILMAGLCLAAEIELPPVEFKPVREIPGDIPTCREGDINISECIKQGLQQI-TPRMKYGISELN 72
            |:.....|||...::         .:.|.|...|:.||   .|||.:....: :.....|...||
  Fly     3 AIAFAVVLCLLVSVD---------AKFPEDPKPCKYGD---GECIMKLCNTLFSENSAEGDPGLN 55

  Fly    73 IPPLDPFEM-------GKSS------YSYTSGLLQGRISMKNVVIHGLSEGIVDKVNFRLKDGRV 124
            :..|||.::       |:||      .::|..||.|....:.|.:.|....:..|...::     
  Fly    56 LMQLDPLKVDRMVISQGESSSPVGITLTFTDNLLYGIKDQRIVKVKGFGRDLTAKHEVKI----- 115

  Fly   125 RMEILSHVPQMF-VEGLYKADIKLNDLKLNPKGAFNITMTDVAMRARPIGELYERDGHTYLRLTK 188
                   |.:.| :.|.|....|:..|.::..|..|:||.:|.......|:...::|.|||.:|.
  Fly   116 -------VTKTFSLVGPYNIQGKVLILPISGTGQSNMTMVNVRAIVSFSGKPLVKNGETYLDVTD 173

  Fly   189 LETEPKVGDLKFYANGLV-PDPVLNDVILDFINQYWRQLYQAMLPETLDTWQPLILKSTNDFFAA 252
            |:...|.....::.:.|. .|..|.|.:..|:|:....:|:........::..|.|......|:.
  Fly   174 LKITMKPESSHYHFSNLFNGDKALGDNMNVFLNENSEAIYKETAKAIDRSFGKLYLGVVKGVFSK 238

  Fly   253 LPF 255
            ||:
  Fly   239 LPY 241

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5867NP_609625.2 JHBP 34..260 CDD:214779 55/239 (23%)
toNP_001287525.1 JHBP 5..245 CDD:284096 58/262 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1405110
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.