| Sequence 1: | NP_609625.2 | Gene: | CG5867 / 34728 | FlyBaseID: | FBgn0027586 | Length: | 262 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001287525.1 | Gene: | to / 43036 | FlyBaseID: | FBgn0039298 | Length: | 249 | Species: | Drosophila melanogaster |
| Alignment Length: | 263 | Identity: | 59/263 - (22%) |
|---|---|---|---|
| Similarity: | 102/263 - (38%) | Gaps: | 40/263 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 9 ALILMAGLCLAAEIELPPVEFKPVREIPGDIPTCREGDINISECIKQGLQQI-TPRMKYGISELN 72
Fly 73 IPPLDPFEM-------GKSS------YSYTSGLLQGRISMKNVVIHGLSEGIVDKVNFRLKDGRV 124
Fly 125 RMEILSHVPQMF-VEGLYKADIKLNDLKLNPKGAFNITMTDVAMRARPIGELYERDGHTYLRLTK 188
Fly 189 LETEPKVGDLKFYANGLV-PDPVLNDVILDFINQYWRQLYQAMLPETLDTWQPLILKSTNDFFAA 252
Fly 253 LPF 255 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG5867 | NP_609625.2 | JHBP | 34..260 | CDD:214779 | 55/238 (23%) |
| to | NP_001287525.1 | JHBP | 5..245 | CDD:284096 | 58/261 (22%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45470496 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR11008 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.940 | |||||