DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5867 and CG1124

Sequence 1:NP_609625.2 Gene:CG5867 FlyBaseID:FBgn0027586 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_649509.1 Gene:CG1124 FlyBaseID:FBgn0037290 Length:246 Species:Drosophila melanogaster

Alignment Length:255 Identity:55/256 (21%)
Similarity:103/256 (40%) Gaps:22/256 (9%)


  Fly     8 VALILMAGLCLAAEIELPPVEFKPVREIPGDIPTCREGDINISECIKQGLQQITPRMKYGISELN 72
            |.|:::.......:.|.||.           |..|...|..:.:|....::.:.|.:..||.::.
  Fly     5 VCLVIVIQALRMVQAETPPY-----------IKQCHRNDPKLVDCFIGAIEHLKPYLANGIPDIQ 58

  Fly    73 IPPLDPFEMGKSSYSYTSGLLQGRISMKNVVIHGLSEGIVDKVNFRLKDGRVRMEILSHVPQMFV 137
            :|.::||:|...:...|.|....:|::||:...|.|...|  .:.:|.:|....:....:|::.:
  Fly    59 LPSVEPFKMDTLALQLTEGPQGYKITLKNMEAFGASNFKV--TSLKLSEGSEPFKAKIVMPKLKI 121

  Fly   138 EGLYKADIKLNDLKLNPKGAFNITMTDVAMRARPIGELYERDGHTYLRLTKLETEPKVGDLKFYA 202
            |..|.:...|..|..:..|.|:.....|:........::...|..||.:..|.....|.|:|...
  Fly   122 EAKYTSSGVLLILPASGGGDFHANFEGVSADLTGKTSIHAFKGANYLHIDALSLVLDVKDVKMSI 186

  Fly   203 NGLVPDPVLNDVILDFINQYWRQLYQAMLPETLDTWQPLILKSTNDFFAALPFDMLVTKN 262
            :|...:   |.::|:..|.:.|:..|.:    |:..|..:.|.....|..|...:|  ||
  Fly   187 SGAFNN---NRILLEATNLFLRENSQVV----LEAMQAQLQKKLASEFGKLANQLL--KN 237

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5867NP_609625.2 JHBP 34..260 CDD:214779 48/226 (21%)
CG1124NP_649509.1 JHBP 6..244 CDD:284096 54/255 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1405051
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.