DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5867 and CG3246

Sequence 1:NP_609625.2 Gene:CG5867 FlyBaseID:FBgn0027586 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_608781.2 Gene:CG3246 FlyBaseID:FBgn0031538 Length:445 Species:Drosophila melanogaster

Alignment Length:218 Identity:55/219 (25%)
Similarity:88/219 (40%) Gaps:38/219 (17%)


  Fly     7 VVALI-LMAGLCLAAEIELPPVEFKPVREIPGDIPTCREGDINIS---ECIKQGLQQITPRMKYG 67
            ||.|: |||..|.....:.|....:.......|....:|...:|:   |.:....||..|:   |
  Fly     6 VVVLVGLMASGCHIVHSQEPGDAVEQEASESDDALKIKESQASIAAQVEAMLVHFQQEDPQ---G 67

  Fly    68 ISELNIPPLDPFEMGKSSYSYTSGLLQGRISMKNVVIHGLSEGIVDKVNFRLKDGRVRMEILSHV 132
            :..:.:|  ||.|:.....|    :....:.||.|..:|||:..:||:|..||:.|....:  .:
  Fly    68 LPGVPVP--DPLEVPNVKKS----MGMANLDMKQVKAYGLSKFRIDKMNLDLKEMRFNGGL--QL 124

  Fly   133 PQMFVEGLYKADIKLNDLKLNPKGAFNITMTDVAMRARPIGELYERDGHTYLRLTKLETEPKVGD 197
            .||.|:|.|    .|:.......|.|.:.:.:|...|.....: ||||       :|.|:....|
  Fly   125 DQMLVKGQY----TLSSFFSKANGPFTVVLKNVYAEATAFLAV-ERDG-------QLATDRIKID 177

  Fly   198 LKFYANGLVPDPVLNDVILDFIN 220
            :.|           :|:.:||.|
  Fly   178 ITF-----------SDMTMDFQN 189

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5867NP_609625.2 JHBP 34..260 CDD:214779 47/191 (25%)
CG3246NP_608781.2 JHBP 31..246 CDD:214779 47/194 (24%)
Grp7_allergen 260..418 CDD:293589
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1402818
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.