DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16813 and CG16815

DIOPT Version :8

Sequence 1:NP_001260438.1 Gene:CG16813 / 34724 FlyBaseID:FBgn0032490 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_609622.2 Gene:CG16815 / 34725 FlyBaseID:FBgn0032491 Length:192 Species:Drosophila melanogaster

Alignment Length:187 Identity:83/188 (44%)
Similarity:105/188 (56%) Gaps:25/188 (13%)


  Fly     1 MDN---YNHKKFTGALKRKRSMDADSDDDVVFIMEQPGQRTPEQPQPKRR----FFRPWMDESPE 58
            |:|   |.|||| ...||||.:|.|.::..         :..|||..|||    |||||:|    
  Fly     1 MENSSSYTHKKF-AVSKRKREVDHDKENQT---------QQSEQPIFKRRQTQGFFRPWLD---- 51

  Fly    59 EEQPQPPRKIVATSTPP--PQQVDGTYHANMVRNHHKRRQRSPQEQLRRDRNTLASLRHRRSQQQ 121
            .||.|...|..:|:..|  |......|.|||||..:..|||||:||:||||||||.|..||::|.
  Fly    52 NEQNQQAEKETSTAAKPSGPGSSVSQYRANMVRRSNTNRQRSPKEQMRRDRNTLACLLSRRAKQA 116

  Fly   122 QQQLIEQQYLTSRIQHEANLQQQIRLSLYYVRFLQQAMASTEPLPPTQPRHMMPRQQ 178
            |::.:.|||...|..|.|.|:||:||||||...||||:......|  .|.|::|:||
  Fly   117 QEEQVGQQYEQYRSHHAAMLEQQVRLSLYYRHILQQAVFQRAINP--APGHILPQQQ 171



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C140836603
eggNOG 1 0.900 E1_2C048
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.