DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5287 and D1005.2

Sequence 1:NP_609608.1 Gene:CG5287 FlyBaseID:FBgn0032477 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_508277.2 Gene:D1005.2 WormBaseID:WBGene00016996 Length:462 Species:Caenorhabditis elegans

Alignment Length:41 Identity:14/42 (33%)
Similarity:19/42 (45%) Gaps:6/42 (14%)


  Fly   219 HQVDSHIFSIYFMLPFLATTLAL----WKFNKYPSQVFVGD 255
            || ||.||.:.:. .||.....:    |||.:...||.:.|
 Worm    25 HQ-DSKIFEVLYS-QFLENQHCIDWNSWKFLEEKHQVTLKD 63

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5287NP_609608.1 GT_GPT_euk 24..320 CDD:133465 14/42 (33%)
D1005.2NP_508277.2 UDPGP 30..432 CDD:279967 10/36 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127672
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.