DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and CG3061

DIOPT Version :10

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster


Alignment Length:132 Identity:45/132 - (34%)
Similarity:67/132 - (50%) Gaps:15/132 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YDVLKVAPDATDEEIKKNYRKLAKEFHPDKN--PDAGDKFKEISFAYEVLSDPEKRRIYDRYGLK 69
            |:||.|:..|||.||||.|:|||.:.|||||  |.|.:.||.:..|..||:|.|||:.||.||:.
  Fly   108 YEVLGVSKTATDSEIKKAYKKLALQLHPDKNKAPGAVEAFKALGNAAGVLTDAEKRKNYDLYGIN 172

  Fly    70 GLQEGAEGFSDASEFFAQWFPFDRVSSEGRGRRNGKVVVKVELTLEEI----YVGGMKKKVEYNR 130
            ....|............|::..:...|.|         .:.:::.||:    :.||..::..:.|
  Fly   173 ESHNGHGNNGGGHHGHGQYYNNEYGYSRG---------FQADISAEELFNMFFNGGFPQQNVHMR 228

  Fly   131 QK 132
            |:
  Fly   229 QQ 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 PTZ00037 1..386 CDD:240236 45/132 (34%)
CG3061NP_650328.1 DnaJ_bact 106..>220 CDD:274090 42/120 (35%)
DUF1977 264..364 CDD:462754
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.