DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and Csp

DIOPT Version :10

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster


Alignment Length:79 Identity:42/79 - (53%)
Similarity:55/79 - (69%) Gaps:4/79 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NLYDVLKVAPDATDEEIKKNYRKLAKEFHPDKNP---DAGDKFKEISFAYEVLSDPEKRRIYDRY 66
            :||::|.:...||.::|||.|||||.::||||||   ||.|||||::.|:.:|||..||.|||.|
  Fly    17 SLYEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQTKRNIYDNY 81

  Fly    67 GLKGLQEGAEGFSD 80
            |..||.. ||.|.:
  Fly    82 GSLGLYI-AEQFGE 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 PTZ00037 1..386 CDD:240236 42/79 (53%)
CspNP_730713.1 DnaJ 17..79 CDD:395170 33/61 (54%)

Return to query results.
Submit another query.