DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-H and CG7133

DIOPT Version :10

Sequence 1:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_649379.1 Gene:CG7133 / 40449 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster


Alignment Length:120 Identity:39/120 - (32%)
Similarity:58/120 - (48%) Gaps:8/120 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YDVLKVAPDATDEEIKKNYRKLAKEFHPDKNPDAGDKFKEISFAYEVLSDPEKRRIYD----RYG 67
            |.||.:..:|||.|||..:|:|:.::|||||.|...:|..|:.|:.||.|.::|.:||    ...
  Fly     9 YQVLGLPRNATDSEIKDAFRRLSLQYHPDKNEDGAKEFLRINEAHRVLIDHQRRALYDCCFQSMD 73

  Fly    68 LKGL--QEGAEGFSDASEFFAQWFPFDRVSSEGRGRRNGKVVVKVELTLEEIYVG 120
            ::.:  .|.|.|  ...|....:||....:.....|...||...:...|...|||
  Fly    74 VEAIIPAENANG--QLPELGNPFFPMPPETPPASFREKLKVAAFIGGLLVGTYVG 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-HNP_001260431.1 PTZ00037 1..386 CDD:240236 39/120 (33%)
CG7133NP_649379.1 DnaJ 7..66 CDD:395170 24/56 (43%)

Return to query results.
Submit another query.