DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pk34A and CG6800

Sequence 1:NP_609603.1 Gene:Pk34A FlyBaseID:FBgn0028410 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_650984.1 Gene:CG6800 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster

Alignment Length:306 Identity:94/307 (31%)
Similarity:154/307 (50%) Gaps:28/307 (9%)


  Fly    43 RIEVKDLIGSGSFGRVYQAHVNESEEIVAVKQTLYNPKLSQGEAEIMGQLKDHN--------NIV 99
            |.::.:.||.|..|.|::|...:..:.||:|:.....|........:.::|...        :|:
  Fly     8 RYKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKVALKNKFGNIALNTLREIKTLQLCKSEYILDII 72

  Fly   100 RLIMHSSVSLGFPSVDYVLLVMEYMPMTLLDYINYHLTVLQPAERLINVRILSYQMFRGLGYLHL 164
            .:         :|.:..:.||:||.|.||.:.:...:..|...:    ||..::|||:|:.|||.
  Fly    73 DI---------YPDLTGLSLVLEYQPDTLYNRLKSEVNPLSRQQ----VRKFAHQMFKGIAYLHE 124

  Fly   165 LGISHRDVKPENLLIDNQKMVLKLSDFGSAKLLVPQEPSISY---ICSRLYRAPELFAGYELYSC 226
            .|:.|||:||.||||.:..| ||::|||.|:|..|::.|..|   :.:|.|||||:..|.:.|..
  Fly   125 AGLMHRDIKPANLLISDTDM-LKIADFGLARLYFPEDESRLYSPQVSTRWYRAPEILFGSQKYGT 188

  Fly   227 AVDIWSAGCVLAELLKGYPLFSSHKHDRKQLRLIVNMLGTDGLERAPEILSKCGNS--LHPRTTR 289
            .||:|:||||:||:|:|.|||:. ..|.:||.:|:..||:..|.:.||:.|....|  ..|.:..
  Fly   189 GVDMWAAGCVVAEMLRGVPLFAG-TTDIEQLAIIIRTLGSPRLNQWPELTSLPDYSKIRFPNSVG 252

  Fly   290 PSWNYLLNTAVPQDLCGLLNSCFIYEAAARISPMMACSHGSYDELR 335
            ..|:.|..:........|:::..:|....|:......|..|...:|
  Fly   253 IHWDNLFPSCTHAVEINLVSNLVVYNPKNRLKASEVGSASSLTPVR 298

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pk34ANP_609603.1 STKc_GSK3 39..334 CDD:271039 93/304 (31%)
S_TKc 45..328 CDD:214567 91/296 (31%)
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 93/302 (31%)
S_TKc 9..288 CDD:214567 90/294 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110894093
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24056
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.