DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pk34A and Cdk8

Sequence 1:NP_609603.1 Gene:Pk34A FlyBaseID:FBgn0028410 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_536735.2 Gene:Cdk8 FlyBaseID:FBgn0015618 Length:454 Species:Drosophila melanogaster

Alignment Length:273 Identity:82/274 (30%)
Similarity:134/274 (49%) Gaps:51/274 (19%)


  Fly    43 RIEVKDL-------IGSGSFGRVYQAHVNESEE--IVAVKQTLYNPKLSQG---EAEIMGQLKDH 95
            |.:|:||       :|.|::|.||:|...|:.:  ..|:|| :....||..   |..::.:|| |
  Fly    13 RTKVEDLFNYEGCKVGRGTYGHVYKAKWKETSDGKEYALKQ-IDGTGLSMSACREIALLRELK-H 75

  Fly    96 NNIVRLI----MHSSVSLGFPSVDYVLLVMEYMPMTLLDYINYHLTVLQPAERLI----NVRILS 152
            .|::.||    .|:...        |.|:::|....|...|.:|.......::::    .|:.|.
  Fly    76 QNVITLIRVFLSHNDRK--------VFLLIDYAEHDLWHIIKFHRAAKATKKQVVVPRGMVKSLL 132

  Fly   153 YQMFRGLGYLHLLGISHRDVKPENLLI---DNQKMVLKLSDFGSAKLL-VPQEPSIS---YICSR 210
            ||:..|:.|||...:.|||:||.|:|:   .|::..:|::|.|.|:|. .|.:|...   .:.:.
  Fly   133 YQILDGIHYLHSNWVLHRDLKPANILVMGDGNERGRVKIADMGFARLFNAPLKPLADLDPVVVTF 197

  Fly   211 LYRAPELFAGYELYSCAVDIWSAGCVLAELLKGYPLFSSHKHDRK--------QLRLIVNMLG-- 265
            .||||||..|...|:.|:|||:.||:.||||...|:|...:.|.|        ||..|.|::|  
  Fly   198 WYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFP 262

  Fly   266 ----TDGLERAPE 274
                .:.:::.||
  Fly   263 QDKDWEDIKKMPE 275

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pk34ANP_609603.1 STKc_GSK3 39..334 CDD:271039 82/274 (30%)
S_TKc 45..328 CDD:214567 81/272 (30%)
Cdk8NP_536735.2 STKc_CDK8_like 19..335 CDD:270834 79/268 (29%)
S_TKc 22..335 CDD:214567 78/265 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111298662
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24056
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.