DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pk34A and CG7028

Sequence 1:NP_609603.1 Gene:Pk34A FlyBaseID:FBgn0028410 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001286884.1 Gene:CG7028 FlyBaseID:FBgn0027587 Length:912 Species:Drosophila melanogaster

Alignment Length:441 Identity:109/442 (25%)
Similarity:161/442 (36%) Gaps:132/442 (30%)


  Fly     2 ENKEKKQKPLKRHAQV-----PLI--IPKN----------------------------SVISTYA 31
            :...::::||:..:..     |||  |||:                            .|.|.:.
  Fly   483 QGSSQRERPLRTPSPTMPCPNPLISEIPKDREDMDNSTSQKTCSAKEKRNEWDMFADQDVDSNFD 547

  Fly    32 VGRLCS------------EPAL------------VRI-EVKD-------LIGSGSFGRVY----Q 60
            |.|..|            .|||            ||| ||.|       ..|.|.|..|.    |
  Fly   548 VSRKISPNTIVQNKHQHENPALTDNWDDAEGYYRVRIGEVLDNRYLVNGYTGQGVFSNVVRGRDQ 612

  Fly    61 AHVNESEEIVAVKQTLYNPKLSQGEAEIMGQLKDHN-----NIVRLIMHSSVSLGFPSVDYVLLV 120
            |....:..|..::......|....|.||:.:|.|.:     :.:||..|      |....::.:|
  Fly   613 ARGQANVAIKIIRNNEIMHKTGLRELEILKKLNDADPEDRFHCLRLYRH------FFHKQHLCMV 671

  Fly   121 MEYMPMTLLDY-------INYHLTVLQPAERLINVRILSYQMFRGLGYLHLLGISHRDVKPENLL 178
            .|.:.|.|.:.       :..|:..         ||..:.|:|..|..|...||.|.|:||:|:|
  Fly   672 FEPLAMNLREVLKKYGKNVGLHIKA---------VRSYTQQLFLALKLLKKTGILHADIKPDNIL 727

  Fly   179 IDNQKMVLKLSDFGSAKLLVPQEPSISYICSRLYRAPELFAGYELYSCAVDIWSAGCVLAELLKG 243
            ::...::|||.|||||..:...|.: .|:.||.||:||:..|.. |...:|.|||||.:.||..|
  Fly   728 VNENNLILKLCDFGSASAISDNEIT-PYLVSRFYRSPEIILGIP-YDYGIDTWSAGCTIYELYTG 790

  Fly   244 YPLFSSHKHDRKQLRLIVNMLG-------TDGLERAPEILSKCGNSLHP-------------RTT 288
            ..|||. |.:.:.|:..:::.|       ..|..|.......|....|.             ...
  Fly   791 KILFSG-KSNNQMLKFFMDVKGKIPNRIIRKGQFREQHFDQSCNFLYHEIDKLTEREKIVVMPVV 854

  Fly   289 RPS----WNYLLNTAVPQD-------LCGLLNSCFIYEAAARISPMMACSH 328
            :||    ...:.:..:|.|       |..||.:.|..:.|.|||...|..|
  Fly   855 KPSRSLQQELIADQNLPDDQHRKVTQLKDLLENMFALDPAKRISLNQALVH 905

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pk34ANP_609603.1 STKc_GSK3 39..334 CDD:271039 96/358 (27%)
S_TKc 45..328 CDD:214567 89/337 (26%)
CG7028NP_001286884.1 STKc_PRP4 591..908 CDD:271037 87/334 (26%)
S_TKc 599..908 CDD:214567 87/326 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111298703
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24056
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.