DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pk34A and Cdk4

Sequence 1:NP_609603.1 Gene:Pk34A FlyBaseID:FBgn0028410 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001286493.1 Gene:Cdk4 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster

Alignment Length:317 Identity:87/318 (27%)
Similarity:140/318 (44%) Gaps:63/318 (20%)


  Fly    48 DLIGSGSFGRVYQAHVNESEEIVAVKQTLYN------PKLSQGEAEIMGQL--KDHNNIVRL--- 101
            ::||.|::|.||:|....:..|||:|:...:      |..:..|..::.||  .:|.|||:|   
  Fly    30 NIIGEGAYGTVYRARDVITGNIVALKKVRISLNENGVPMSTLREISLLKQLNASNHANIVKLYEV 94

  Fly   102 --IMHSSVSLGFPSVDYVLLVMEYMPMTLLDYINYHLTVLQPAERL-------INVRILSYQMFR 157
              .:.....|      .:|||.|::...|.|.|          :||       ..::.||.::..
  Fly    95 CQFLERDGQL------LILLVFEHVEQDLSDLI----------DRLPKSGMSPPTIQRLSRELLT 143

  Fly   158 GLGYLHLLGISHRDVKPENLLIDNQKMVLKLSDFGSAKLLVPQEPSISYICSRLYRAPELFAGYE 222
            |:.:||...|.|||:||:|||:.:|.. ||::|||.||....:....|.:.:..|||||:... :
  Fly   144 GVDFLHSHRIIHRDLKPQNLLVSSQGH-LKIADFGLAKTYGSEMKLTSVVVTLWYRAPEVLLA-Q 206

  Fly   223 LYSCAVDIWSAGCVLAELLKGYPLFSSHKHDRKQLRLIVNMLGTDGLERAPEILSKCGNSL---H 284
            .|:..||||||.|::.|:.....||.. ..::.||..|..:.|....::.|:.:|......   |
  Fly   207 PYNSTVDIWSAACIIFEMFNRRALFPG-TSEKNQLDRIFELTGRPTEQQWPQTISVALEHFPQRH 270

  Fly   285 PRTTRPSWNYLLNTAVPQDLC--------GLLNSCFIYEAAARISPMMACSHGSYDE 333
            |:.             |:|.|        .|||....|:...|.|.:....|..:.:
  Fly   271 PKR-------------PKDFCPHLCKYADDLLNKMLSYDLHLRPSALACLEHDYFQQ 314

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pk34ANP_609603.1 STKc_GSK3 39..334 CDD:271039 87/318 (27%)
S_TKc 45..328 CDD:214567 86/311 (28%)
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 87/314 (28%)
S_TKc 26..312 CDD:214567 87/314 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111306660
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24056
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.