| Sequence 1: | NP_609603.1 | Gene: | Pk34A / 34705 | FlyBaseID: | FBgn0028410 | Length: | 392 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_002084.2 | Gene: | GSK3B / 2932 | HGNCID: | 4617 | Length: | 433 | Species: | Homo sapiens | 
| Alignment Length: | 367 | Identity: | 141/367 - (38%) | 
|---|---|---|---|
| Similarity: | 201/367 - (54%) | Gaps: | 27/367 - (7%) | 
- Green bases have known domain annotations that are detailed below.
| 
 
  Fly    25 SVISTYAVGRLCSEPALVRIEVKDLIGSGSFGRVYQAHVNESEEIVAVKQTLYNPKLSQGEAEIM 89 
  Fly    90 GQLKDHNNIVRL--IMHSSVSLGFPSVD-YVLLVMEYMPMTLLDYINYHLTVLQPAERLINVRIL 151 
  Fly   152 SYQMFRGLGYLHLLGISHRDVKPENLLIDNQKMVLKLSDFGSAKLLVPQEPSISYICSRLYRAPE 216 
  Fly   217 LFAGYELYSCAVDIWSAGCVLAELLKGYPLFSSHKHDRKQLRLIVNMLGTDGLERAPEILSKCGN 281 
  Fly   282 SLHPRTTRPSWN-------------YLLNTAVPQDLCGLLNSCFIYEAAARISPMMACSHGSYDE 333 
  Fly   334 LRIMDAMALPMPNGNPLPPLFDFNSLEMGTDPKLWVNLLPIH 375  | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| Pk34A | NP_609603.1 | STKc_GSK3 | 39..334 | CDD:271039 | 122/310 (39%) | 
| S_TKc | 45..328 | CDD:214567 | 118/298 (40%) | ||
| GSK3B | NP_002084.2 | STKc_GSK3 | 51..356 | CDD:271039 | 122/310 (39%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 42 | 1.000 | Domainoid score | I12443 | 
| eggNOG | 1 | 0.900 | - | - | E2759_KOG0658 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D990896at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 1 | 0.960 | - | - | ||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 5 | 4.780 | |||||