DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pk34A and C44H4.6

Sequence 1:NP_609603.1 Gene:Pk34A FlyBaseID:FBgn0028410 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_510429.1 Gene:C44H4.6 WormBaseID:WBGene00008095 Length:367 Species:Caenorhabditis elegans

Alignment Length:398 Identity:126/399 (32%)
Similarity:193/399 (48%) Gaps:70/399 (18%)


  Fly     3 NKEKKQKPLKRHAQVPLIIPKNSVISTYAVGRLCSEPALVRIEVKDLIGSGSFGRVYQAHVNESE 67
            |:.::......|      :..::|::....|........::.....|||:||||.||:|.:.|::
 Worm     2 NRMRRSTAFSEH------VTFHTVMAKRGTGSKLDREVEIQFTNLQLIGTGSFGAVYKAVLREND 60

  Fly    68 EIVAVKQTLYNPKLSQGEAEIMGQLKDHNNIVRL----IMHSSVSLGFPSVDYVLLVMEYMPMTL 128
            |.:|:|:...:.:....|..||.:: ||.||:||    :|.....|.|        |||:||..|
 Worm    61 EPIAIKKIKVDDRFKSRELTIMHEM-DHPNIIRLLYYYVMQQENCLNF--------VMEFMPKDL 116

  Fly   129 LDYIN---YHLTVLQPAERLINVRILSYQMFRGLGYLHLLGISHRDVKPENLLIDNQKMVLKLSD 190
            . |::   .|.....||   .::::..:|:.||:|:|||..|.|||:||:|||:|....:||:.|
 Worm   117 A-YVHRQFAHNDKQMPA---YSIKLYMFQLLRGIGFLHLHNIVHRDIKPKNLLVDESNGILKICD 177

  Fly   191 FGSAKLLVPQEPSISYICSRLYRAPELFAGYELYSCAVDIWSAGCVLAELLKGYPLFSSHKHDRK 255
            |||||.|...||:|:|||||.||||||..|.:.|..::|.||.|.|:.|||...|:|.:   |..
 Worm   178 FGSAKRLEKNEPNITYICSRYYRAPELIFGSKNYDTSIDTWSVGTVVGELLHNSPIFLA---DSA 239

  Fly   256 Q--LRLIVNMLGTDGLERAPEILSKCGNSLHPRTTRPSWNYLLNTAVPQD-LCG----------- 306
            .  |.|.:...||.    :.|.::|             |||.. ..:|.| :.|           
 Worm   240 VDILALQIKAFGTP----SKEDMAK-------------WNYEY-VHIPYDTITGVGIQKFIGRKL 286

  Fly   307 ------LLNSCFIYEAAARISPMMACSHGSYDELRIMDAMALPMPNGNPLPPLFDFNSLEMGTDP 365
                  ||||....:...||.|..|.:...:|:||   .....:|:|.|:|||||:...|...:.
 Worm   287 SLSTLELLNSLMKMDPKLRIKPYEALTLPYFDDLR---DPHYKLPSGAPIPPLFDWLEREYIANH 348

  Fly   366 KLWVNLLP 373
            ::..::.|
 Worm   349 EIIKDIFP 356

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pk34ANP_609603.1 STKc_GSK3 39..334 CDD:271039 110/322 (34%)
S_TKc 45..328 CDD:214567 109/310 (35%)
C44H4.6NP_510429.1 STKc_GSK3 32..320 CDD:271039 110/322 (34%)
S_TKc 37..317 CDD:214567 109/314 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C140913301
eggNOG 1 0.900 E2759_KOG0658
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S376
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D990896at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.750

Return to query results.
Submit another query.