DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pk34A and gsk3b

Sequence 1:NP_609603.1 Gene:Pk34A FlyBaseID:FBgn0028410 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_017945668.1 Gene:gsk3b XenbaseID:XB-GENE-487098 Length:426 Species:Xenopus tropicalis

Alignment Length:336 Identity:137/337 (41%)
Similarity:196/337 (58%) Gaps:18/337 (5%)


  Fly    49 LIGSGSFGRVYQAHVNESEEIVAVKQTLYNPKLSQGEAEIMGQLKDHNNIVRL--IMHSSVSLGF 111
            :||:||||.||||.:.::.|:||:|:.|.:.:....|.:||.:| ||.|||||  ..:||   |.
 Frog    61 VIGNGSFGVVYQAKLCDTGELVAIKKVLQDKRFKNRELQIMRKL-DHCNIVRLRYFFYSS---GE 121

  Fly   112 PSVD-YVLLVMEYMPMTLLDYINYHLTVLQPAERLINVRILSYQMFRGLGYLHLLGISHRDVKPE 175
            ...: |:.||::|:|.|:. .:..|.:..:.|..:|.|::..||:||.|.|:|..||.|||:||:
 Frog   122 KKDEVYLNLVLDYVPETVY-RVARHYSRAKQALPMIYVKLYMYQLFRSLAYIHSFGICHRDIKPQ 185

  Fly   176 NLLIDNQKMVLKLSDFGSAKLLVPQEPSISYICSRLYRAPELFAGYELYSCAVDIWSAGCVLAEL 240
            |||:|.:..||||.||||||.||..||::||||||.||||||..|...|:.::|:||||||||||
 Frog   186 NLLLDPETAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAEL 250

  Fly   241 LKGYPLFSSHKHDRKQLRLIVNMLGTDGLERAPEILSKCGNSLHPRTTRPSWN------YLLNTA 299
            |.|.|:|.... ...||..|:.:|||...|:..|:.........|:.....|.      .:....
 Frog   251 LLGQPIFPGDS-GVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKGYVFLQVFRAR 314

  Fly   300 VPQDLCGLLNSCFIYEAAARISPMMACSHGSYDELRIMDAMALPMPNGNPLPPLFDFNSLEMGTD 364
            .|.:...|.:....|...||::|:.||:|..:||||..:   |.:|||...|.||:|.:.|:.::
 Frog   315 TPPEAIALCSRLLEYTPTARLTPLDACAHSFFDELRDPN---LKLPNGREFPALFNFTTQELSSN 376

  Fly   365 PKLWVNLLPIH 375
            |.|...|:|.|
 Frog   377 PSLSSILIPAH 387

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pk34ANP_609603.1 STKc_GSK3 39..334 CDD:271039 121/294 (41%)
S_TKc 45..328 CDD:214567 118/288 (41%)
gsk3bXP_017945668.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0658
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D990896at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.870

Return to query results.
Submit another query.