DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Yip1d1 and YIPF5

Sequence 1:NP_609596.1 Gene:Yip1d1 FlyBaseID:FBgn0032465 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001020118.1 Gene:YIPF5 HGNCID:24877 Length:257 Species:Homo sapiens

Alignment Length:276 Identity:129/277 (47%)
Similarity:175/277 (63%) Gaps:31/277 (11%)


  Fly     1 MSQFGGPN-DFYGSAPSAD----ASYNFDMPEFGQELNFQTFDNTQAS--VPPNYDASYAQPPSQ 58
            ||.|...| |||.::.|.|    .||::..........:..:|.:|..  |||:    ..||...
Human     1 MSGFENLNTDFYQTSYSIDDQSQQSYDYGGSGGPYSKQYAGYDYSQQGRFVPPD----MMQPQQP 61

  Fly    59 GLGGFYDPT-AYTDTS----YGQDKSGKSAAGGGAGNEFDDEPPLLEELGINPNHIFQKTLAVLN 118
            ..|..|.|| |||..|    |              ||.|:||||||||||||.:||:||||.||:
Human    62 YTGQIYQPTQAYTPASPQPFY--------------GNNFEDEPPLLEELGINFDHIWQKTLTVLH 112

  Fly   119 PLRGTDQQILQDTDMAGPLVFCLTLGGFLLLSGKVTFSYIYGIGVMGCIFFYCLLSLMVSRSQVT 183
            ||:..|..|:.:||:|||:||||..|..|||:||:.|.|:|||..:||:..:|||:|| |.:.|:
Human   113 PLKVADGSIMNETDLAGPMVFCLAFGATLLLAGKIQFGYVYGISAIGCLGMFCLLNLM-SMTGVS 176

  Fly   184 FGAVASVLGYCLLPMVVLSGINILITIQGTLGLIVSGISIFWCAISASKLFATAFSMDHQQLLIA 248
            ||.||||||||||||::||...::.::||.:|:|::...|.||:.||||:|.:|.:|:.||||:|
Human   177 FGCVASVLGYCLLPMILLSSFAVIFSLQGMVGIILTAGIIGWCSFSASKIFISALAMEGQQLLVA 241

  Fly   249 YPCAVLYGGFALITIY 264
            ||||:|||.||||:::
Human   242 YPCALLYGVFALISVF 257

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Yip1d1NP_609596.1 Yip1 <95..264 CDD:304430 98/169 (58%)
YIPF5NP_001020118.1 Interaction with Sec23 75..106 20/45 (44%)
Yip1 <89..257 CDD:328794 98/169 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C35932921
eggNOG 1 0.900 E1_COG5080
Hieranoid 1 1.000
Homologene 1 1.000 H56969
Inparanoid 1 1.050 227 1.000 Inparanoid score I3428
Isobase 1 0.950 0 Normalized mean entropy S991
OMA 1 1.010
OrthoDB 1 1.010 D1457080at2759
OrthoFinder 1 1.000 FOG0001770
OrthoInspector 1 1.000 T609850
orthoMCL 1 0.900 OOG5_127686
Panther 1 1.100 O PTHR21236
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1888
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.