DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Yip1d1 and yipf4

Sequence 1:NP_609596.1 Gene:Yip1d1 FlyBaseID:FBgn0032465 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_998056.1 Gene:yipf4 ZFINID:ZDB-GENE-040426-2253 Length:237 Species:Danio rerio

Alignment Length:270 Identity:67/271 (25%)
Similarity:110/271 (41%) Gaps:46/271 (17%)


  Fly     2 SQFGGPNDFYGSAPSADASYNFDMPE----FGQELNFQTFDNTQASVPPNYDASYAQPPSQGLGG 62
            |...|...|..|..:.:.|...|.|:    .|.|.|..|:..|...             .:|.|.
Zfish     4 SPTNGDFTFVSSTDAEELSGTIDAPDITLNMGPESNRDTYATTFLR-------------QRGYGW 55

  Fly    63 FYDPTAYTDTSYGQDKSGKSAAGGGAGNEFDDEPPLLEELGINPNHIFQKTLAVLNPL--RGTDQ 125
            ..:...                     .|.:|..||||||.|:...|:.|...||.|:  .|.::
Zfish    56 LLEVEE---------------------EESEDTKPLLEELDIDLKDIYYKIRCVLMPMPSLGFNR 99

  Fly   126 QILQDT-DMAGPLVFCLTLGGFLLLSGKVTFSYIYGIGVMGCIFFYCLLSLMVSRSQVTFGAVAS 189
            |:::|. |..|||...|......:.......|:|..|.:.|.:..:.|..::  ..:|::|.|..
Zfish   100 QVVRDNPDFWGPLAVVLLFSMISIYGQFRVVSWIITIWIFGSLTIFLLARVL--GGEVSYGQVLG 162

  Fly   190 VLGYCLLPMVVLSGINILITIQGTLGLIVSGISIFWCAISASKLFATAFSMDHQQLLIAYPCAVL 254
            |:||.|||::|::.:.::|.....:..::....:||.|.||:.|.........:.||| ||..:|
Zfish   163 VIGYSLLPLIVIAPLLLVIGGFEVVSTLIKLFGVFWAAYSAASLLVGDEFKTKKPLLI-YPIFLL 226

  Fly   255 YGGFALITIY 264
            |..|  :::|
Zfish   227 YIYF--LSLY 234

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Yip1d1NP_609596.1 Yip1 <95..264 CDD:304430 50/172 (29%)
yipf4NP_998056.1 Yip1 <69..230 CDD:304430 49/164 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5080
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.