DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Yip1d1 and Yipf7

Sequence 1:NP_609596.1 Gene:Yip1d1 FlyBaseID:FBgn0032465 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_006251101.1 Gene:Yipf7 RGDID:1310766 Length:289 Species:Rattus norvegicus

Alignment Length:263 Identity:119/264 (45%)
Similarity:162/264 (61%) Gaps:23/264 (9%)


  Fly     9 DFYGS---APSADASYNFDMPEFGQELNFQTFDNTQASVPPNYDASYAQPPSQGLGGFYDPTAYT 70
            |||.|   ..:.:.||| |...:|   ||  :.:.|.........|...||...|...|....:.
  Rat    43 DFYQSNYIIDNQEQSYN-DSNAYG---NF--YGSRQPQAREQCQPSSPVPPEMFLSSDYGGQLFQ 101

  Fly    71 DTS----YGQDKSGKSAAGGGAGNEFDDEPPLLEELGINPNHIFQKTLAVLNPLRGTDQQILQDT 131
            ..|    |.|..|..|         ||:|||||||||||.:||:||||.||||::..|..|:.:|
  Rat   102 PASNLHYYSQSSSVDS---------FDEEPPLLEELGINFDHIWQKTLTVLNPMKPADGSIMNET 157

  Fly   132 DMAGPLVFCLTLGGFLLLSGKVTFSYIYGIGVMGCIFFYCLLSLMVSRSQVTFGAVASVLGYCLL 196
            |:.||::||:.||..||::||..|.||||:..:||...:.||:|| |.|.|::|.||||||||||
  Rat   158 DLTGPILFCVALGATLLMAGKAQFGYIYGMSAIGCFGIHALLNLM-SSSGVSYGCVASVLGYCLL 221

  Fly   197 PMVVLSGINILITIQGTLGLIVSGISIFWCAISASKLFATAFSMDHQQLLIAYPCAVLYGGFALI 261
            |||:||...:..::|||.|.:.:.:.|.||::||||:|.:|.:|:.||||:|||||:|||.|||:
  Rat   222 PMVILSSCAVFFSLQGTAGTMSALLIITWCSLSASKIFISALAMEGQQLLVAYPCALLYGLFALL 286

  Fly   262 TIY 264
            |::
  Rat   287 TVF 289

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Yip1d1NP_609596.1 Yip1 <95..264 CDD:304430 95/169 (56%)
Yipf7XP_006251101.1 Yip1 <111..289 CDD:304430 100/188 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C35932645
eggNOG 1 0.900 E1_COG5080
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 221 1.000 Inparanoid score I3408
OMA 1 1.010
OrthoDB 1 1.010 D1457080at2759
OrthoFinder 1 1.000 FOG0001770
OrthoInspector 1 1.000 T618784
orthoMCL 1 0.900 OOG5_127686
Panther 1 1.100 LDO PTHR21236
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
1211.770

Return to query results.
Submit another query.