DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Yip1d1 and Yipf6

Sequence 1:NP_609596.1 Gene:Yip1d1 FlyBaseID:FBgn0032465 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001020918.1 Gene:Yipf6 RGDID:1566154 Length:236 Species:Rattus norvegicus

Alignment Length:235 Identity:56/236 (24%)
Similarity:96/236 (41%) Gaps:42/236 (18%)


  Fly    45 PPNYDASYAQPPSQGLGGFYDPTAYTDTSYGQD--KSGKSAAGGGAGNEFDDEPPLLEELG---- 103
            |...:|:.::|...||         :|.|..||  ..|:.....|...:..|...|.|.:.    
  Rat     8 PGEQEATSSKPLFAGL---------SDVSISQDIPIEGEITIPSGTRAQECDSSTLNESIRRTIM 63

  Fly   104 INPNHIFQKTLAVLNPLRGTDQQILQDTDMAGPLVFCLTLGGFLLLS--------GKVTFSYIYG 160
            .:...:.:|.:.||.|.:  ...:|:|.|:.|||:.|::|...|..|        |...|:.::.
  Rat    64 RDLKAVGRKFMHVLYPRK--SNTLLRDWDLWGPLILCVSLALMLQKSSVEGKRDGGSPEFAEVFV 126

  Fly   161 IGVMGCIFFYCLLSLMVSRSQVTFGAVASVLGYCLLPMVVLSGINILITIQG------TLGLIVS 219
            |...|.:..  .|:..:....::|.....|||||:||:.:...|..|:.:.|      .:.|.|.
  Rat   127 IIWFGAVTI--TLNSKLLGGNISFFQSLCVLGYCVLPLNIAMLICRLLLLAGQGPINFMIRLFVV 189

  Fly   220 GISIFWCAISASKLFATAFSMD----HQQLLIAYPCAVLY 255
            .:...|..|:     :|||..|    :::.|..||..:.|
  Rat   190 LVMFAWSVIA-----STAFLADCQPPNRKALAVYPVFLFY 224

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Yip1d1NP_609596.1 Yip1 <95..264 CDD:304430 44/184 (24%)
Yipf6NP_001020918.1 Yip1 2..232 CDD:304430 56/236 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5080
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.