| Sequence 1: | NP_609596.1 | Gene: | Yip1d1 / 34696 | FlyBaseID: | FBgn0032465 | Length: | 264 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001009712.1 | Gene: | Yipf4 / 362699 | RGDID: | 1310157 | Length: | 246 | Species: | Rattus norvegicus | 
| Alignment Length: | 254 | Identity: | 69/254 - (27%) | 
|---|---|---|---|
| Similarity: | 112/254 - (44%) | Gaps: | 47/254 - (18%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    45 PPNYDASYAQPPSQGLGGFYDPTAYTDTSYGQDKSGKSAAGG-----GAGNEF------------ 92 
  Fly    93 ----------DDEP----PLLEELGINPNHIFQKTLAVLNPL--RGTDQQILQDT-DMAGPLVFC 140 
  Fly   141 LTLGGFLLLSGKVTFSYIYGIGVMGCIFFYCLLSLMVSRSQVTFGAVASVLGYCLLPMVVLSGIN 205 
  Fly   206 ILITIQGTLGLIVSGISIFWCAISASKLFATAFSMDHQQLLIAYPCAVLYGGFALITIY 264 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| Yip1d1 | NP_609596.1 | Yip1 | <95..264 | CDD:304430 | 52/175 (30%) | 
| Yipf4 | NP_001009712.1 | Yip1 | <76..239 | CDD:419731 | 50/165 (30%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG5080 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||