DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ACXC and adcy7

Sequence 1:NP_609593.1 Gene:ACXC FlyBaseID:FBgn0040508 Length:1130 Species:Drosophila melanogaster
Sequence 2:XP_021333246.1 Gene:adcy7 ZFINID:ZDB-GENE-040713-1 Length:1119 Species:Danio rerio

Alignment Length:1212 Identity:326/1213 (27%)
Similarity:538/1213 (44%) Gaps:274/1213 (23%)


  Fly    41 KELNLEEEYRYYQVRLMVSNLTIFYVLFIILAMSFLTIELLYVQHYNAVFFNFVIR--------- 96
            :||..|..||.:      |.::.:....::|.:|.:|...|.|     :||:|.::         
Zfish    12 QELKQEALYRKF------SGISQYRQFVLLLGLSIVTCATLLV-----LFFSFKLKAQNHGIFVG 65

  Fly    97 -VVSTILVLTVLSINFCEKFVSRHRW-VMIASSVLSVYLVV-LTDIVMISYHFYKNDWPLNTSFD 158
             |...:.:...:.:..|.:.:|: || .::...|.:.:|.: .|.|...........|. ...|.
Zfish    66 VVGGALCLFLAVFVLVCTETLSQ-RWRTLLGLGVWATHLTMGFTFIFSTKSDLQIQPWD-QVPFF 128

  Fly   159 VFTLCMIYMFLPIPSIKGAALLASSVSLIYVAFFMHSLTFNAVYTDRDSFGYDVISTDILHNLGF 223
            :|.:..:|..||. .:..|.:|:...||.::......||...::::..:|  .::|..::...|.
Zfish   129 LFIIITVYTMLPF-QMSYAVILSIISSLSHIIVLSVYLTVAQLHSNPITF--QLLSNAVVFGCGI 190

  Fly   224 NMMGIFFRIMNDTMVRASFLDRHQFIMEETWLRHALLQESILLDSILPPQIAK----PVQEKIKS 284
             |:|||.:::.:..::.:|.|..:.:.....|.....|:..||.|:||..|:.    .:.|:.|.
Zfish   191 -MVGIFHKVLMEKALKQTFQDTLRCLGIRMKLEIEKRQQENLLQSVLPVYISMKMKLAIMERCKC 254

  Fly   285 KITQSENSPDRFQMGPRTTESFMAIQI--HPDVSILYADVVNYTHLTTTLTVGNLVKVLHDLYGR 347
            |..:.:....|       ..:|.::.:  |.:|||||||:|.:|.|.:..:...||.:|::|:|:
Zfish   255 KDKEEQQRMVR-------DNNFHSLYVKRHENVSILYADIVGFTRLASDCSPKELVLMLNELFGK 312

  Fly   348 FDIAASNFKVQRIKFLGDCYYCVAGLTTPDPDHAKCCVSLGISMISNIQEVRAERGLDIDMRIGV 412
            ||..|...:..|||.||||||||:||....|:|||.||.:|:.|...|::||...|:||:||:||
Zfish   313 FDQIAKENECMRIKILGDCYYCVSGLPVSLPNHAKNCVKMGLDMCEAIKQVREATGVDINMRVGV 377

  Fly   413 HSGSLLAGIIGEAKLQFDIWGTDVEIANHLESTGEPGYVHVSGRTLSMLNPADYTILSGTQKAQS 477
            |||::|.|:||..|.|||:|..||.:|||:||.|.||.||::..||..||.| |.:..|....: 
Zfish   378 HSGNVLCGVIGLRKWQFDVWSHDVTLANHMESGGLPGRVHITEATLKHLNKA-YEVEEGNGHLR- 440

  Fly   478 DPVLQ--YIHTYLLTGQVARESFI--TSIGGVRSSSVLEVKSIDRIRSSRPSQSSMTD----EFR 534
            |..|:  .|.|:|:....:::|.:  .||...|.|..|::::..|:.....|..::..    :.|
Zfish   441 DTYLKELNIKTFLVIDPRSKDSSLMAPSITKPRVSDGLKMRASVRMTRFLESWGAVKPFAHLQSR 505

  Fly   535 EEF------------RNMPVGGINLNSP------------------------CCRRTRLD--THK 561
            |||            :::|:..:..::|                        ..::|:.|  .|.
Zfish   506 EEFNTDAMVNGKGHCKDIPLRSVPTHNPDSFDESLEEPFSLPAPPLSTYNRNKSQKTKFDEELHD 570

  Fly   562 K---------------TQREIGIFCAAF--KDSSLEWNYLHQPDFIFKSSMLLAWGIGC------ 603
            |               ...||......|  ||..:::..:..|:|        .:.|||      
Zfish   571 KMTTTINDLSSSKQWVKSEEISGLTLWFTKKDLEMQYRTIEMPNF--------KYYIGCATFIFI 627

  Fly   604 CLIYIQIVTN--------NFSCTACIVVDLVTFFFLTSLLCLAWYKNVCWWKSGRYEFRIYGKYS 660
            |:..||::..        .|:..||         ||..:||:                       
Zfish   628 CIFIIQMLVTKQRIELGLGFAVLAC---------FLLLILCI----------------------- 660

  Fly   661 CMAFHIF----EKIQHSVSL----RITV---YLGILFSYYAVISLIMLN------------CDRD 702
            |.|.||.    ||::....|    :..|   ::.||.:..|...::::.            ||..
Zfish   661 CFADHIQRMFPEKLKSCTWLLALSKAVVKRPFVRILLATVATTVIVVIAMFELFLKKTDNLCDLL 725

  Fly   703 MYELSYIESKIYHYEMDRDTC-FHPWVFTNMISLILGISYTFARIPFGLKIVISCCETLAYLLIV 766
            ....|:.:|.       ||.. :.|::..|.|..::... .|.|:.|.||:......:|....|:
Zfish   726 QQNSSFADSA-------RDELQYLPYLVYNCILALIACG-VFLRVSFELKLAFLLIVSLVSYTII 782

  Fly   767 FFQFAFIF---------QHS------ATTTPFMK-AELAHCLRVCMMLLTMYAKERQSEFNTKMN 815
            .:....:|         .||      ......|| .::..|:.:.:.|.||....||:|:..:.:
Zfish   783 LYSQENLFSNYNCLLYTNHSCGDSLMVCKAGLMKHPKIMSCIYITLFLFTMLLISRQNEYCCRQD 847

  Fly   816 YKL-NVDLQNKQKAADLTNQSIIILLNNILPSHVVDLYLNSLAKHE----------------LYY 863
            :.| |.:|.:|:: .:|......:||.|:||:||..|::....|:|                |||
Zfish   848 FLLKNKNLADKEE-VELCENLNRLLLENVLPAHVAALFVGENKKNEVGLLSAISLLNRKYKDLYY 911

  Fly   864 ENYRMVSVMFAMLINF----------PMNLPSLRVLNDIITQFDRLLTAYREYYVVEKIKVVGCT 918
            ::|..|.||||.:.:|          ...|..||:||:||..||.||:. .::..|||||.:|.|
Zfish   912 KSYDCVCVMFASVPDFKEFYTECDINKEGLECLRLLNEIIADFDELLSK-PKFSGVEKIKTIGST 975

  Fly   919 YMAACGLDFNLASNIRQTDHFRNSSLHVEVEHARNHRMTDENYDSDMNNDEVVFIMTTFALDLMR 983
            ||||.|    |:....|::..|                  |..::.:.|      |..||:.|:.
Zfish   976 YMAAAG----LSGPPEQSNQDR------------------ERQNAQIGN------MVEFAIALIG 1012

  Fly   984 TLAACNRAYSSSFFERSLSQGKICIGISSGEIMAGVVGASQPHYDIWGNPVNMASRMESTGLPGH 1048
            .|...||...::|        ::.:||:.|.::|||:||.:|.||||||.||:||||||||..|.
Zfish  1013 KLDGINRHSFNTF--------RLRVGINHGPVIAGVIGARKPQYDIWGNTVNVASRMESTGELGK 1069

  Fly  1049 IQVTEESAKILQEFDIKCIYRGMTFVKGRGDIPTYFVGIDEN 1090
            ||||||::.:||.....|..||:..|||:|::.|:||..|.:
Zfish  1070 IQVTEETSIVLQNLGYSCECRGLINVKGKGELKTFFVCTDSS 1111

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ACXCNP_609593.1 AC_N <33..285 CDD:292831 54/260 (21%)
CYCc 293..468 CDD:214485 82/177 (46%)
Nucleotidyl_cyc_III 307..466 CDD:299850 79/161 (49%)
CYCc 833..1060 CDD:214485 89/253 (35%)
Nucleotidyl_cyc_III 861..1085 CDD:299850 89/234 (38%)
adcy7XP_021333246.1 AC_N <129..248 CDD:318454 27/123 (22%)
Guanylate_cyc 272..455 CDD:306677 86/185 (46%)
DUF1053 487..613 CDD:310728 16/126 (13%)
Guanylate_cyc 909..1106 CDD:306677 89/234 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110430987
eggNOG 1 0.900 E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D181177at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45627
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.