DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ACXC and Ac78C

Sequence 1:NP_609593.1 Gene:ACXC FlyBaseID:FBgn0040508 Length:1130 Species:Drosophila melanogaster
Sequence 2:NP_001262138.1 Gene:Ac78C FlyBaseID:FBgn0024150 Length:1727 Species:Drosophila melanogaster

Alignment Length:1376 Identity:331/1377 (24%)
Similarity:525/1377 (38%) Gaps:417/1377 (30%)


  Fly    36 LREKCKELNLEEEYRYY-----QVRLMVSNLTIFYVLFIILAMSFL--TIELLYVQHYNAVFFNF 93
            |....|:.:||..|..|     |..|::.|: :.:||.|:||..::  ..||..::..:......
  Fly   303 LTNSFKQSSLERSYLTYTHRQRQKSLIIVNV-VDFVLKIVLAFVWIMRRSELGPIESDDGTSMAT 366

  Fly    94 VI--RVVSTILVLTVLSINFCEKFVSRH-RWVMIASSVL---------------SVYLVVLTDIV 140
            .|  .|...|..:.:..:.:...|.:.: .|..:.:.||               ..|||      
  Fly   367 AITWSVCCGIANMAICFLGYWRCFANNYLHWAAVCTWVLFNIQGFVGQGVGFADREYLV------ 425

  Fly   141 MISYHFYKNDWPLNTSFDVFTLCMIYMFLPIP---SIKGAALLAS-SVSLIYVAFFMH-SLTFNA 200
                      |     :.:|.:.:.|..||:|   .:.|..:.|| .:::|.:....| ..|.|.
  Fly   426 ----------W-----YILFVIFVPYAMLPLPLKWCVVGGTITASCHLAVITIIKLQHGEATINP 475

  Fly   201 VYTDRDSFGYDVISTDILHNLGFNMMGIFFRIMNDTMVRASFLDRHQFIMEETWLRHALLQESIL 265
                 :...:.:.:..||:. ..|:.|::.:.:.|...|.:|::.|:.:..:......|.:...|
  Fly   476 -----ECVLFQIFANFILYT-AINVAGMYTKYLTDRGQRLAFIETHKAMEHKKESEKELQRTQKL 534

  Fly   266 LDSILPPQIAKPVQEKIKSKITQSENSPDRFQMGPRTTESFMAIQIHP--DVSILYADVVNYTHL 328
            ||||||    ..|..:|:|::.:..:        |.....|..:.::|  :||||:||:..:|.|
  Fly   535 LDSILP----NIVNNQIRSEMYKGTD--------PTVETQFNKLYVYPMDNVSILFADIKGFTEL 587

  Fly   329 TTTLTVGNLVKVLHDLYGRFDIAASNFKVQRIKFLGDCYYCVAGLTTPD----PDHAKCCVSLGI 389
            .:..:...|||:|:||:.|||..|.:....|:|.||||||||:...:.:    ||||.|.|..|:
  Fly   588 ASKTSAQQLVKILNDLFARFDRIAEDNHCLRVKLLGDCYYCVSQFESDNWKTRPDHAVCSVETGL 652

  Fly   390 SMISNIQEVRAERGLDIDMRIGVHSGSLLAGIIGEAKLQFDIWGTDVEIANHLESTGEPGYVHVS 454
            .||..|::||....:|::||||:||||::.|::|..|..||:|..||.||||:||.|.||.||:|
  Fly   653 HMIKAIKDVRLHTHVDLNMRIGIHSGSVMCGVLGNKKWHFDVWSNDVIIANHMESGGIPGRVHIS 717

  Fly   455 GRTLSMLNPADYTILSGTQKAQSDPV-LQYIHTYL--------------------LTGQVA---- 494
            ..||..||.| |.:..|....:.:.: :..:.|||                    |.|.||    
  Fly   718 EATLKCLNDA-YEVEPGNGGCRDNHLKMLNVKTYLIKRTEPLRPKRRFGTRSSAHLAGSVATAAP 781

  Fly   495 ------------RESFITSIGGVRSS--------------------------------------- 508
                        ..|...|||||.::                                       
  Fly   782 PCATPTALPKSISASGSGSIGGVTATGNDGASIDGRSLEYAATIAVPAQQPTQLLQQQQKKNISL 846

  Fly   509 ----SVLEVKSID--RIRSS--------------------------------------RP----- 524
                :|:|..::|  |||:.                                      ||     
  Fly   847 NSLPNVVEGVAMDSRRIRNGCGVMGGAGGTGGGGTGPCGMSTVSSPTAMMSAPLEVQLRPRNGAC 911

  Fly   525 ----------------SQSSMTDEFRE-EFRNM--PVGGIN-----------------------L 547
                            ...|.||...| .|:|:  |..|:|                       :
  Fly   912 SIQNLAEAIDGKGLIIEDESTTDWIPEIPFKNLNSPEDGLNRADSILVDTKEDHRVSVAVLDEEI 976

  Fly   548 NSPCCRRTRLDTHKKTQRE-IGIFCAAFKDSSLEWNYLHQPDFIFKSSMLLAWGIGCCLIYIQIV 611
            :....:..:::::|:.:|| :..:...|||.|.|..:....:.:|:|:||..:.|...::..|::
  Fly   977 DEFIEQNIQINSNKEIRREYLNPWTLKFKDKSQEQKFCQLREDMFRSNMLCVFVIWIFMVLCQVI 1041

  Fly   612 TNNFSCT---ACIVVDLVTFFFLTSLL----------CLAWYKNVCWWKSGRYEFRIYGKY--SC 661
            ... .||   .|:.|..|...|...|:          ||.........:..|....|.|..  .|
  Fly  1042 IIP-RCTRLIICLSVGTVILTFCCVLVMAEEFPGLPRCLKTNSAKLVHQRQRRTLFICGVIVSMC 1105

  Fly   662 M-----------AFHIFEKIQHSVSLR----------------ITVYLGILFSYYAVIS------ 693
            |           :.:|....:||..||                :.|||.....:...||      
  Fly  1106 MLSAIGLVLCPSSTYIGTADEHSRFLRMVSPYSNISMTEKEFKLNVYLSATIHHNITISTPASGG 1170

  Fly   694 ----------------------LIMLNC------------------DRDMYELSYIESKIYHYEM 718
                                  .:.||.                  ...:..|||.::.:.....
  Fly  1171 PTPLVDITSSGPSDEFVRSTLNALTLNLTPPLPQSHRPYTLTTNGHSVSLSNLSYSDASVMQSSS 1235

  Fly   719 D-RDTCFHP--WVFTNMISLILGISYTFARIPFGLKIVISCCETLAYLLIVFFQFAFIFQHSATT 780
            | ...|.||  .|||.::.|:        .:...||:.. ..:.|..|.:|.|....|.....:.
  Fly  1236 DVEGQCAHPEYLVFTWVLCLV--------SLATALKLYY-LVKALMALAMVAFYTTLIMMKFGSG 1291

  Fly   781 TPFMKAELAH----------CLRVCMMLLTMYAKERQSEFNTKMNYKLNVDLQNKQKAADLTNQS 835
            ..|...||:.          .|.:..:::..| ..|..|..:::::     :..:|...:|||..
  Fly  1292 DSFSLVELSRLGMPLGVQMLILLISFLVMVCY-HARLVEVTSRLDF-----IWKEQAERELTNMK 1350

  Fly   836 IIILLN-----NILPSHVVDLYLNSLAKHELYYENYRMVSVMFAMLINF--------PMNLPSLR 887
            ....||     ||||.||...||:.....|||.:.:.:..||||.:.||        ......:|
  Fly  1351 SNRALNDTLIKNILPDHVATYYLSDEHTDELYSKMHNLCGVMFASIPNFQDFYSEDIDNGKACIR 1415

  Fly   888 VLNDIITQFDRLLTAYREYYVVEKIKVVGCTYMAACGLDFNLASNIRQTDHFRNSSLHVEVEHAR 952
            :||:||..||.||...| :..|||||.||.|||||.||:.                     ||.|
  Fly  1416 ILNEIICDFDELLEEPR-FASVEKIKTVGATYMAAAGLNH---------------------EHLR 1458

  Fly   953 NHRMTDENYDSDMNNDEVVFIMTTFALDLMRTLAACNRAYSSSFFERSLSQGKICIGISSGEIMA 1017
            ....|.|:...|         :..||..:.:.|...|....::|        ::.:||.||.:::
  Fly  1459 LRGETSEDSVCD---------LVEFAFAMKQKLEEINGDAFNNF--------QLRVGICSGPLVS 1506

  Fly  1018 GVVGASQPHYDIWGNPVNMASRMESTGLPGHIQVTEESAKILQEFDIKCIYRGMTFVKGRGDIPT 1082
            ||:||.:|.||||||.||:||||:|||....:||.|.:|::|......|:.||...|||:|.:.|
  Fly  1507 GVIGARKPVYDIWGNTVNVASRMDSTGENWRVQVPENTAELLCSRGYTCVKRGEIAVKGKGMMTT 1571

  Fly  1083 YFV---GIDEN 1090
            ::|   ||.|:
  Fly  1572 FYVHPKGISES 1582

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ACXCNP_609593.1 AC_N <33..285 CDD:292831 58/279 (21%)
CYCc 293..468 CDD:214485 78/181 (43%)
Nucleotidyl_cyc_III 307..466 CDD:299850 75/165 (45%)
CYCc 833..1060 CDD:214485 84/240 (35%)
Nucleotidyl_cyc_III 861..1085 CDD:299850 80/232 (34%)
Ac78CNP_001262138.1 AC_N <288..551 CDD:292831 58/280 (21%)
CYCc 526..729 CDD:214485 89/216 (41%)
Guanylate_cyc 566..753 CDD:278633 80/188 (43%)
DUF1053 929..1020 CDD:283888 17/91 (19%)
CYCc 1353..1554 CDD:214485 83/240 (35%)
Guanylate_cyc 1381..1576 CDD:278633 81/234 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45627
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.