DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ACXC and CG32301

Sequence 1:NP_609593.1 Gene:ACXC FlyBaseID:FBgn0040508 Length:1130 Species:Drosophila melanogaster
Sequence 2:NP_728724.2 Gene:CG32301 FlyBaseID:FBgn0052301 Length:1111 Species:Drosophila melanogaster

Alignment Length:1185 Identity:376/1186 (32%)
Similarity:583/1186 (49%) Gaps:190/1186 (16%)


  Fly    23 LDY---ANERLWEHSYLREKCKELNLEEEYRYY-------QVRLMVSNLTIFYVLFIILAMSFL- 76
            :||   .|...:|...||.||:||.||..|..:       .|..::..:.|..::.:||..|.: 
  Fly    10 VDYRSLGNMPGYEWKLLRYKCRELRLEGVYHRHCHLVSVALVTQLIIVIEILMLIHVILLFSVVK 74

  Fly    77 TIELLYVQHYNAVFFNFVIRVVSTILVLTVLSINFCEKFVSRHRWVMIASSVLSVYLVVLTDIVM 141
            .|:.|.|..|.||           :|:...:.:...|..|.::..:.|..|.|...|:...|:::
  Fly    75 NIDFLTVLPYFAV-----------MLLTPSILMPSREPNVEQYESIAILVSCLMALLLTAMDLIL 128

  Fly   142 ISYHFYKNDWPLNTSFDVFTLCMIYMFLPIPSIKG--AALLASSVSLIYVAFFMHSLTFNAVYTD 204
            ...:|  ..:.|..|:|...:.:||:..||..:|.  |..|..:|||.|                
  Fly   129 PICYF--RPFSLVPSYDHVVIVLIYLMFPIAFVKNGRAYFLGLAVSLFY---------------- 175

  Fly   205 RDSFGY----DVIST-DILHNLG--------FNMMGIFFRIMNDTMVRASFLDRHQFIMEETWLR 256
               |||    |.||| |.:..|.        .||:.:|.....:..:|:..|.|:|.:.:....:
  Fly   176 ---FGYMALIDKISTLDKVWELTAYGAYLFFLNMLCMFLSRFQEYNMRSGILSRYQVVYQNLVFQ 237

  Fly   257 HALLQESILLDSILPPQIAKPVQEKIKSKITQSENSPDRFQMGPRTTESFMAIQIHPDVSILYAD 321
            .|:.:|..|||||:|..:|:.:|:.|.|.|   |..|.......:|...||  :.||:||||.||
  Fly   238 MAMKEEKALLDSIIPVTLARSLQDAIASHI---EEDPSNLMPFTKTRHLFM--EPHPEVSILEAD 297

  Fly   322 VVNYTHLTTTLTVGNLVKVLHDLYGRFDIAASNFKVQRIKFLGDCYYCVAGLTTPDPDHAKCCVS 386
            :|::|.||||:.|.:||.:||:|:..||:||::.:..|||||||.|.||.|:.:..|.||..||:
  Fly   298 MVDFTGLTTTMEVSDLVAILHELFVSFDLAANHNRATRIKFLGDSYTCVTGIPSYFPTHANACVN 362

  Fly   387 LGISMISNIQEVRAERGLDIDMRIGVHSGSLLAGIIGEAKLQFDIWGTDVEIANHLESTGEPGYV 451
            ..:.||...:||...|...||:|||||||.:||||||..|.|||||..||:|.|.|||:|.||.|
  Fly   363 QALDMIEISREVSKRRNKKIDLRIGVHSGEILAGIIGLTKWQFDIWSKDVDITNRLESSGLPGMV 427

  Fly   452 HVSGRTLSMLNPADYTILSGTQKAQSDPVLQ--YIHTYLL---------TGQVARESFITSIGGV 505
            |:|.|||.:|: ..|....||..|:.||:||  .:.|||:         |..:..::|  |:...
  Fly   428 HISSRTLGLLD-NHYVYEEGTDTAKLDPLLQRSNLSTYLIRSRLPNFEDTDDLEDDNF--SLNDY 489

  Fly   506 RSS-----------------SVLEVK--SIDRIRS---SRPSQSSMTDEFREEFRNMPVGGINLN 548
            |.|                 .:|||:  .::|:::   .||......::..||:           
  Fly   490 RFSFSFSQDYEDIQVKAQRDMILEVEHMPVNRVQTCKIRRPMHRIAKEDINEEY----------- 543

  Fly   549 SPCCRRTRLDTHKKTQREIGIFCAAFKDSSLEWNYLHQPDFIFKSSMLLAWGIGCCLIYIQIVTN 613
                 |..|:::        .....|:...:||::....|.:.|.|:.:....|..:|.:.::..
  Fly   544 -----RFHLESY--------YLFTTFRSWRMEWSFNKMRDLLMKYSLGMMVFAGATIIAMDLLVK 595

  Fly   614 NFSCTACIVVDLVTFFFLTSLLCLAWYKNVCWWKSGR----------YEFRIYGKYSCMAFHIFE 668
            :.:....::..|  |..:...|.||.||.:  |..||          :..|.:.|.|       :
  Fly   596 SEAMDYTMLFSL--FLLILLPLLLASYKKL--WLRGRRLSPITQPTFFLSRWFIKAS-------D 649

  Fly   669 KIQHSVSLRITVYLGILFSYYAVISLIMLNCDRDMYELSYIESKIYHYEMDRDTCFHPWVFTNMI 733
            .|:.||.:||.:.:.:||..|.:.|..:.:||....||..|.|:: |....:..||.||..|..:
  Fly   650 LIEKSVFVRIPLAIMVLFLLYVMSSETVFSCDIARLELEIINSEL-HNLRPQMLCFMPWGVTYAV 713

  Fly   734 SLILGISYTFARIPFGLKIVISCCETLAYLLIVFFQFAFIFQHSATTTPFMKAELAHCLRVCMML 798
            .::|.:......||..:|:.:......::::.|...:.|.|:.|.||...:.:.|||...:....
  Fly   714 VIVLSLMLVIIGIPLIIKLGVGLAILGSHVITVHAYYGFAFERSQTTNIGVTSSLAHSWYMVAFF 778

  Fly   799 LTMYAKERQSEFNTKMNYKLNVDLQNKQKAADLTNQSIIILLNNILPSHVVDLYLNSLAKHELYY 863
            :.:..:|....:..|.:|.:::..:.|.:...:..::|.|::.||||:||.:::.......:|||
  Fly   779 IVVVVREGYLNYILKASYFMSMCFEKKHELTKVKTRTIKIIMANILPTHVAEVFKVRRRSDQLYY 843

  Fly   864 ENYRMVSVMFAMLINFPMNLPSLRVLNDIITQFDRLLTAYREYYVVEKIKVVGCTYMAACGLDFN 928
            ||:..|:||||.:.|:..:...||.|:::|..||.||..|:.:|.:|||||:|.||:|||||   
  Fly   844 ENFSQVAVMFATIENYEADKSGLRALHEMICYFDELLVNYQSWYKIEKIKVMGWTYLAACGL--- 905

  Fly   929 LASNIRQTDHFRNSSLHVEVEHARNHRMTDENYDS------DMNNDEV----------------- 970
                  ..||:.:.|:.|.:.   .:|.:|:...|      .|:.||:                 
  Fly   906 ------HVDHYTDFSVSVPIS---TNRESDKLQKSGSVRFAPMDGDEIMIKDLHPTQATTNEDDN 961

  Fly   971 -VFIMTTFALDLMRTLAACNRAYSSS--FFER-SLSQGKICIGISSGEIMAGVVGASQPHYDIWG 1031
             :.:||.|||:|:|.|    |...|.  |||: |...|.:.|||:.|.:||||||.|:|||||||
  Fly   962 TILVMTEFALNLLRIL----RDIRSKGIFFEKDSKLTGSLKIGIAHGPVMAGVVGLSKPHYDIWG 1022

  Fly  1032 NPVNMASRMESTGLPGHIQVTEESAKILQEFDIKCIYRGMTFVKGRGDIPTYFVGIDENLKFMSA 1096
            :.|||||||.|||:...|.|||.:|.:|::|:|:|.|||||||||.|.:|||.|.:||||.|...
  Fly  1023 HTVNMASRMTSTGVRDGIHVTESTANVLRDFNIRCTYRGMTFVKGVGQVPTYLVDLDENLHFQQH 1087

  Fly  1097 KLVNRSLSRRFSVMS 1111
            ...|.  |.:.|::|
  Fly  1088 SPDND--SHKGSIVS 1100

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ACXCNP_609593.1 AC_N <33..285 CDD:292831 71/275 (26%)
CYCc 293..468 CDD:214485 88/175 (50%)
Nucleotidyl_cyc_III 307..466 CDD:299850 84/159 (53%)
CYCc 833..1060 CDD:214485 101/254 (40%)
Nucleotidyl_cyc_III 861..1085 CDD:299850 109/251 (43%)
CG32301NP_728724.2 Nucleotidyl_cyc_III 283..439 CDD:299850 85/159 (53%)
CYCc 812..1051 CDD:214485 101/255 (40%)
Nucleotidyl_cyc_III 841..1076 CDD:299850 109/251 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110300383
eggNOG 1 0.900 E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D181177at33208
OrthoFinder 1 1.000 FOG0006603
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45627
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.