DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kek1 and Islr

Sequence 1:NP_001303320.1 Gene:kek1 FlyBaseID:FBgn0015399 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_001119772.1 Gene:Islr RGDID:1596359 Length:428 Species:Rattus norvegicus

Alignment Length:382 Identity:87/383 (23%)
Similarity:139/383 (36%) Gaps:79/383 (21%)


  Fly    90 CQTVCACKWKGGKQTVECIDRHLIQIPEHIDPNTQVLDMSGNKLQTLSNEQFIRANLLNLQKLYL 154
            |...|.|..|.|.|..:|..|.|..:|.....|...|.:|.|:|..|....|....|  ||.|:|
  Rat    19 CPEACDCGEKYGFQIADCAYRDLDGVPPGFPANVTTLSLSANRLPVLLEGSFREVPL--LQSLWL 81

  Fly   155 RNCKIGEIERETFKGLTNLVELDLSHNLLVTVPSLALGHIPSLRELTLASNHIHKIESQAFGNTP 219
            .:.:|..:.......|.:|..|||||||:.......|.::.:|:.|.:.||.:      ||    
  Rat    82 AHNEIRSVAVGALAPLGHLKSLDLSHNLISEFAWSDLHNLSALQLLKMDSNEL------AF---- 136

  Fly   220 SLHKLDLSHCDIQTISAQAFGGLQGLTLLRLNGNKLSELLPKTIETLSRLHGIELHDNPWLCDCR 284
                          |...||..|..|..|:||.|:|..|...|...|:.|..::::.||:.|.|.
  Rat   137 --------------IPRDAFRSLHALRSLQLNHNRLHALAEGTFAPLTSLSHLQINHNPFDCTCG 187

  Fly   285 LRDTKLWLMKRNIPYP-------VAP-VCSGGPERIIDRSFADLHVDEFACRPEMLPISHY---- 337
            :...|.|.:...:..|       .:| |..|.|   :.|      :....|....:.:|:.    
  Rat   188 IVWFKTWALATAVSIPEQDNIACTSPHVLKGTP---LSR------LPPLPCSAPSVQLSYQPSQD 243

  Fly   338 -VEAAMGENASITCRARAVPAANINWY----------------WNGRLLANNSAFTAYQRIHMLE 385
             .|...|...::.|.....|...::|:                .:||.|....|.:...|.... 
  Rat   244 GAELRPGFVLALHCDVDGQPVPQLHWHIHTPGGTVEIASPNVGTDGRPLPGALAASGQPRFQAF- 307

  Fly   386 QVEGGFEKRSKLVLTNAQETDSSEFYCVAENRAGMAEANFTLHVSMRAAGMASLGSG 442
                   ....|::.:..:.:...:.|:|.|..|.||::..:       .:|:.|.|
  Rat   308 -------ANGSLLIPDFGKLEEGTYSCLATNELGSAESSVNV-------ALATPGEG 350

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kek1NP_001303320.1 leucine-rich repeat 103..122 CDD:275380 5/19 (26%)
LRR_RI <119..277 CDD:238064 43/158 (27%)
leucine-rich repeat 123..148 CDD:275380 7/25 (28%)
LRR_8 148..207 CDD:290566 19/59 (32%)
leucine-rich repeat 149..172 CDD:275380 6/23 (26%)
leucine-rich repeat 173..196 CDD:275380 9/23 (39%)
LRR_8 195..255 CDD:290566 15/60 (25%)
leucine-rich repeat 197..220 CDD:275380 6/23 (26%)
leucine-rich repeat 221..244 CDD:275380 4/23 (17%)
leucine-rich repeat 245..268 CDD:275380 9/23 (39%)
LRRCT 277..327 CDD:214507 12/58 (21%)
IG_like 338..429 CDD:214653 17/107 (16%)
Ig 346..426 CDD:143165 15/96 (16%)
IslrNP_001119772.1 leucine-rich repeat 32..51 CDD:275380 5/19 (26%)
LRR_RI <39..>181 CDD:238064 47/168 (28%)
LRR_8 51..110 CDD:290566 22/61 (36%)
leucine-rich repeat 52..75 CDD:275380 6/23 (26%)
leucine-rich repeat 76..99 CDD:275380 6/23 (26%)
leucine-rich repeat 100..123 CDD:275380 9/23 (39%)
LRR_8 124..182 CDD:290566 22/82 (27%)
leucine-rich repeat 124..147 CDD:275380 10/47 (21%)
leucine-rich repeat 148..171 CDD:275380 9/23 (39%)
LRRCT 180..228 CDD:214507 12/57 (21%)
I-set 239..343 CDD:254352 17/119 (14%)
Ig 255..341 CDD:143165 15/94 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24366
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.