DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kek1 and Lingo4

Sequence 1:NP_001303320.1 Gene:kek1 FlyBaseID:FBgn0015399 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_001102659.1 Gene:Lingo4 RGDID:1562025 Length:618 Species:Rattus norvegicus

Alignment Length:582 Identity:138/583 (24%)
Similarity:201/583 (34%) Gaps:214/583 (37%)


  Fly    83 PAQQQSTCQTVCACKWKGGKQT--VECIDRHLIQIPEHIDPNTQVLDMSGNKLQTLSNEQFIRAN 145
            |....|:|.|:|.|.    .||  |.|..|.|..:|..:..:|:|||:|||:|..|......|  
  Rat    49 PGGSISSCPTLCDCT----SQTRAVLCAHRRLDTVPGGLPLDTEVLDLSGNRLWGLQRGMLSR-- 107

  Fly   146 LLNLQKLYLRNCKIGEIERETFKGLTNLV------------------------------------ 174
            |..||:|.|...::..:|...|.||.:|:                                    
  Rat   108 LGQLQELDLSYNQLSTLEPGAFHGLQSLLTLRLQGNRLRIVGPGIFSGLSALTLLDLRLNQIVLF 172

  Fly   175 ------------ELDLSHNLLV------------------------TVPSLALGHIPSLRELTLA 203
                        :|::..|.||                        |||.|||..:|:|..|.|.
  Rat   173 LDGAFGELGSLQQLEVGDNHLVFVAPGAFSGLAKLSTITLERCNLSTVPGLALAQLPALVALRLR 237

  Fly   204 SNHIHKIESQA-----------FGNTPSLHKLD-------------LSHCDIQTISAQAFGGLQG 244
            ...|.::.|.|           ..:.|||..||             ::||::.::..||...|..
  Rat   238 ELDIERLPSGALRGLGQLKELEIHHWPSLEALDPGSLVGLNLSSLAITHCNLSSVPFQALHHLSF 302

  Fly   245 LTLLRLNGNKLSELLPKTIETLSRL------------------HG-------------------- 271
            |.:|.|:.|.:|.:..:.:..|.||                  ||                    
  Rat   303 LQVLDLSQNPISAIPARRLSPLVRLQELRLSGACLTSIAAHAFHGLTAFHLLDVADNALQTLEET 367

  Fly   272 ----------IELHDNPWLCDCRLRDTKLWL--MKRNIPYPVAPVCSGGPERIID---RSFAD-L 320
                      :.|..||..|||||    |||  ::|.:.:..:|....||:.:..   |.|:| |
  Rat   368 AFPSPDKLVTLRLSGNPLTCDCRL----LWLLRLRRRLDFGTSPPACAGPQHVQGKNLREFSDIL 428

  Fly   321 HVDEFACRPEMLPIS--HYVEAAMGENASITCRARAVPAANINWY-----WNGRLLANNSAFTAY 378
            ....|.|:|.::..|  .:|.|..|.:|..:|.....||..::|.     |.||:          
  Rat   429 PPGHFTCKPALIRKSGPRWVIAEEGGHAVFSCSGDGDPAPTVSWMRPQGSWLGRV---------- 483

  Fly   379 QRIHMLEQVEGGFEKRSKLVLTNAQETDSSEFYCVAENRAG------------MAEANFTL---H 428
            .|:.:||  :|..|.||      .|..|...:.||..|.||            :...|.||   :
  Rat   484 GRVRVLE--DGTLEIRS------VQLRDRGAYVCVVSNVAGNDSLRTWLEVIQVEPPNGTLSDPN 540

  Fly   429 VSMRA-AGMASLGSGQIVGLSAALVALIVFALGVIMCLLL---------RVKRQPYVDSKTP 480
            |:|.. .|..||.|..:..:.|  |..:.|...|.:|..|         |||.....|...|
  Rat   541 VTMPGIPGPFSLDSRGVAMVLA--VGFLPFLTSVTLCFGLIALWSKGKGRVKHHMTFDFVAP 600

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kek1NP_001303320.1 leucine-rich repeat 103..122 CDD:275380 7/21 (33%)
LRR_RI <119..277 CDD:238064 58/302 (19%)
leucine-rich repeat 123..148 CDD:275380 11/25 (44%)
LRR_8 148..207 CDD:290566 23/131 (18%)
leucine-rich repeat 149..172 CDD:275380 8/23 (35%)
leucine-rich repeat 173..196 CDD:275380 12/95 (13%)
LRR_8 195..255 CDD:290566 21/84 (25%)
leucine-rich repeat 197..220 CDD:275380 7/34 (21%)
leucine-rich repeat 221..244 CDD:275380 8/36 (22%)
leucine-rich repeat 245..268 CDD:275380 6/23 (26%)
LRRCT 277..327 CDD:214507 19/56 (34%)
IG_like 338..429 CDD:214653 28/111 (25%)
Ig 346..426 CDD:143165 23/97 (24%)
Lingo4NP_001102659.1 leucine-rich repeat 87..110 CDD:275380 11/25 (44%)
LRR_8 88..145 CDD:290566 19/59 (32%)
LRR_4 88..126 CDD:289563 15/40 (38%)
LRR_RI 110..345 CDD:238064 44/235 (19%)
leucine-rich repeat 111..134 CDD:275380 8/23 (35%)
LRR_8 134..193 CDD:290566 3/59 (5%)
leucine-rich repeat 135..158 CDD:275380 1/23 (4%)
leucine-rich repeat 159..182 CDD:275380 0/23 (0%)
LRR_8 182..237 CDD:290566 14/55 (25%)
leucine-rich repeat 183..206 CDD:275380 4/23 (17%)
leucine-rich repeat 207..230 CDD:275380 7/23 (30%)
leucine-rich repeat 231..254 CDD:275380 6/23 (26%)
leucine-rich repeat 255..302 CDD:275380 10/47 (21%)
LRR_8 278..334 CDD:290566 13/56 (23%)
leucine-rich repeat 303..326 CDD:275380 6/23 (26%)
LRR_8 326..385 CDD:290566 7/59 (12%)
leucine-rich repeat 327..348 CDD:275380 3/21 (14%)
leucine-rich repeat 351..374 CDD:275380 0/23 (0%)
IG_like 445..526 CDD:214653 25/99 (25%)
Ig 456..526 CDD:299845 22/88 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T131073
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.