DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kek1 and LINGO4

Sequence 1:NP_001303320.1 Gene:kek1 FlyBaseID:FBgn0015399 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_001004432.1 Gene:LINGO4 HGNCID:31814 Length:593 Species:Homo sapiens

Alignment Length:604 Identity:136/605 (22%)
Similarity:198/605 (33%) Gaps:217/605 (36%)


  Fly    64 DGYMPPSQHFPPTHSDLDP-------PAQQQSTCQTVCACKWKGGKQTVECIDRHLIQIPEHIDP 121
            |....|.|.:||    ..|       |.....:|..||.|  ....|.|.|..|.|..:|..:..
Human     2 DAATAPKQAWPP----WPPLLFLLLLPGGSGGSCPAVCDC--TSQPQAVLCGHRQLEAVPGGLPL 60

  Fly   122 NTQVLDMSGNKLQTLSNEQFIRANLLNLQKLYLRNCKIGEIERETFKGLTNLVE----------- 175
            :|::||:|||:|..|......|.:|  ||:|.|...::..:|...|.||.:|:.           
Human    61 DTELLDLSGNRLWGLQQGMLSRLSL--LQELDLSYNQLSTLEPGAFHGLQSLLTLRLQGNRLRIM 123

  Fly   176 -------------LDLSHNLLV------------------------------------------- 184
                         |||..|.:|                                           
Human   124 GPGVFSGLSALTLLDLRLNQIVLFLDGAFGELGSLQKLEVGDNHLVFVAPGAFAGLAKLSTLTLE 188

  Fly   185 -----TVPSLALGHIPSLRELTLASNHIHKIESQAFGNT-----------PSLHKLD-------- 225
                 |||.|||..:|:|..|.|....|.::.:.|....           |||..||        
Human   189 RCNLSTVPGLALARLPALVALRLRELDIGRLPAGALRGLGQLKELEIHLWPSLEALDPGSLVGLN 253

  Fly   226 -----LSHCDIQTISAQAFGGLQGLTLLRLNGNKLSELLPKTIETLSRL---------------- 269
                 ::.|::.::..||...|..|.:|.|:.|.:|.:..:.:..|.||                
Human   254 LSSLAITRCNLSSVPFQALYHLSFLRVLDLSQNPISAIPARRLSPLVRLQELRLSGACLTSIAAH 318

  Fly   270 --HG------------------------------IELHDNPWLCDCRLRDTKLWL--MKRNIPYP 300
              ||                              :.|..||..|||||    |||  ::|::.:.
Human   319 AFHGLTAFHLLDVADNALQTLEETAFPSPDKLVTLRLSGNPLTCDCRL----LWLLRLRRHLDFG 379

  Fly   301 VAPVCSGGPERIIDRS---FAD-LHVDEFACRPEMLPIS--HYVEAAMGENASITCRARAVPAAN 359
            ::|....||..:..:|   |:| |....|.|:|.::..|  .:|.|..|.:|..:|.....||..
Human   380 MSPPACAGPHHVQGKSLKEFSDILPPGHFTCKPALIRKSGPRWVIAEEGGHAVFSCSGDGDPAPT 444

  Fly   360 INWY-----WNGRLLANNSAFTAYQRIHMLEQVEGGFEKRSKLVLTNAQETDSSEFYCVAENRAG 419
            ::|.     |.||.          .|:.:||  :|..|.||      .|..|...:.||..|.||
Human   445 VSWMRPHGAWLGRA----------GRVRVLE--DGTLEIRS------VQLRDRGAYVCVVSNVAG 491

  Fly   420 MAEANFTLHVSMRAAGMASLGSGQIV-------------GLSAAL-VALIVFALGVIMCLLL--- 467
            .......|.|........:|....|.             |::..| |..:.|...|.:|..|   
Human   492 NDSLRTWLEVIQVEPPNGTLSDPNITVPGIPGPFFLDSRGVAMVLAVGFLPFLTSVTLCFGLIAL 556

  Fly   468 ------RVKRQPYVDSKTP 480
                  |||.....|...|
Human   557 WSKGKGRVKHHMTFDFVAP 575

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kek1NP_001303320.1 leucine-rich repeat 103..122 CDD:275380 6/19 (32%)
LRR_RI <119..277 CDD:238064 56/302 (19%)
leucine-rich repeat 123..148 CDD:275380 10/25 (40%)
LRR_8 148..207 CDD:290566 24/131 (18%)
leucine-rich repeat 149..172 CDD:275380 8/23 (35%)
leucine-rich repeat 173..196 CDD:275380 13/95 (14%)
LRR_8 195..255 CDD:290566 19/84 (23%)
leucine-rich repeat 197..220 CDD:275380 6/34 (18%)
leucine-rich repeat 221..244 CDD:275380 7/36 (19%)
leucine-rich repeat 245..268 CDD:275380 6/23 (26%)
LRRCT 277..327 CDD:214507 19/56 (34%)
IG_like 338..429 CDD:214653 26/96 (27%)
Ig 346..426 CDD:143165 22/85 (26%)
LINGO4NP_001004432.1 LRRNT 31..64 CDD:214470 11/35 (31%)
leucine-rich repeat 62..85 CDD:275380 9/23 (39%)
LRR_8 65..120 CDD:290566 18/57 (32%)
leucine-rich repeat 86..109 CDD:275380 8/23 (35%)
LRR_RI 87..320 CDD:238064 42/233 (18%)
LRR_8 109..168 CDD:290566 6/59 (10%)
leucine-rich repeat 110..133 CDD:275380 1/23 (4%)
leucine-rich repeat 134..157 CDD:275380 5/23 (22%)
LRR_8 157..212 CDD:290566 10/55 (18%)
leucine-rich repeat 158..181 CDD:275380 0/23 (0%)
leucine-rich repeat 182..205 CDD:275380 7/23 (30%)
leucine-rich repeat 206..229 CDD:275380 5/23 (22%)
leucine-rich repeat 230..277 CDD:275380 9/47 (19%)
LRR_8 253..309 CDD:290566 12/56 (21%)
leucine-rich repeat 278..301 CDD:275380 6/23 (26%)
LRR_8 301..360 CDD:290566 7/59 (12%)
leucine-rich repeat 302..325 CDD:275380 3/23 (13%)
leucine-rich repeat 326..344 CDD:275380 0/18 (0%)
leucine-rich repeat 350..362 CDD:275378 3/12 (25%)
IG_like 420..501 CDD:214653 26/99 (26%)
Ig 431..501 CDD:299845 23/88 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T130055
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.