DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kek1 and Islr2

Sequence 1:NP_001303320.1 Gene:kek1 FlyBaseID:FBgn0015399 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_001155007.1 Gene:Islr2 MGIID:2444277 Length:789 Species:Mus musculus

Alignment Length:637 Identity:139/638 (22%)
Similarity:218/638 (34%) Gaps:166/638 (26%)


  Fly    90 CQTVCACKWKGGKQTVECIDRHLIQIPEHIDPNTQVLDMSGNKLQTLSNEQFIRANLLNLQKLYL 154
            |...|||..|...|..:|..:.|.::||.:..|...|.:|.||:..|....|:  |:..:..|:|
Mouse    64 CPEPCACVDKYAHQFADCAYKELREVPEGLPANVTTLSLSANKITVLRRGAFV--NVTQVTSLWL 126

  Fly   155 RNCKIGEIERETFKGLTNLVELDLSHNLLVTVPSLALGHIPSLRELTLASNHIHKIESQAFGNTP 219
            .:.::..:|......|:.|..|||||||:...|      ...||.|:                  
Mouse   127 AHSEVRTVESGALAVLSQLKNLDLSHNLISNFP------WSDLRNLS------------------ 167

  Fly   220 SLHKLDLSHCDIQTISAQAFGGLQGLTLLRLNGNKLSELLPKTIETLSRLHGIELHDNPWLCDCR 284
            :|..|.::|..:.::...|.|.|..|..||:|.|:|..|.|.|.:.||.|..::|:.||:.|.|.
Mouse   168 ALQLLKMNHNRLGSLPRDALGALPDLRSLRINNNRLRTLEPGTFDALSALSHLQLYHNPFHCSCG 232

  Fly   285 LRDTKLWLM------KRNIPYPVAPVCSGGPERIIDRSFADLH-VDEFACRP-------EMLPIS 335
            |    :||.      :.::|.|.:..|:..||    .....:| :....|.|       |..|.:
Mouse   233 L----VWLQAWAASTRVSLPEPDSIACASPPE----LQGVPVHRLPALPCAPPSVRLSAEPPPEA 289

  Fly   336 HYVEAAMGENASITCRARAVPAANINWYWNGRLLANNSAFTAYQRIHMLEQVEGGFEKRSKLVLT 400
            .......|....:.|.|...|...:.|..                     |:.||.......|| 
Mouse   290 PGTPLRAGLAFMLHCVAEGHPTPRLQWQL---------------------QIPGGTVVLVPPVL- 332

  Fly   401 NAQETDSSEFYCVAENRAG------------------------------MAEANFTLHV---SMR 432
             ::|.|..:   ..|:..|                              :|.||.:|.|   |.:
Mouse   333 -SKEEDGGD---KVEDGEGDGDEDLPTQTEAPTPTPAPAWPAPPATPRFLALANGSLLVPLLSAK 393

  Fly   433 AAGMASLGSGQIVGLSAALVALIVFALGVIMCLLLRVKRQPYV----DSKTPNHMEVITSVNHQN 493
            .||:.:..:...:|.::..:.:.|.|.|       ..|..|..    |::.|......|:....|
Mouse   394 EAGIYTCRAHNELGTNSTSLRVTVAAAG-------PPKHAPGTGEEPDAQVPTSERKATTKGRSN 451

  Fly   494 SITNKTQPATGNGSIGGVVIANGAVANIIDGGVVQGGTLERKSSG---RGGVPHGVHDQRSANPV 555
            |:.    |....|...|..:|..:|...|:      ..||....|   .|.:|        |:|:
Mouse   452 SVL----PFKPEGKTKGQGLARVSVLGEIE------AELEETDEGEQMEGQIP--------ADPM 498

  Fly   556 QK-------PPRLTDLPYSTQGYDNNGSVLS-----------TASCFISPSGSTGNGGNNPDLIN 602
            .:       |.|........|..|....|..           .|...::|..:  ..|..||..:
Mouse   499 GEKHCGHGDPSRYVSNHAFNQSSDLKPHVFELGVIALDVAEREARVQLTPLAA--RWGPGPDGAS 561

  Fly   603 DTKRFGSDEFADLKIPPISGVGVGGSGEYSRANGCDSLYPSGLWEHGAPVGT 654
            ..:|.|......|.:.|..|   |.:.::||.....:.|    |..|...||
Mouse   562 GARRPGRRPLRLLYLCPAGG---GTAVQWSRVEEGVNAY----WFRGLRPGT 606

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kek1NP_001303320.1 leucine-rich repeat 103..122 CDD:275380 5/19 (26%)
LRR_RI <119..277 CDD:238064 43/158 (27%)
leucine-rich repeat 123..148 CDD:275380 7/25 (28%)
LRR_8 148..207 CDD:290566 16/59 (27%)
leucine-rich repeat 149..172 CDD:275380 4/23 (17%)
leucine-rich repeat 173..196 CDD:275380 9/23 (39%)
LRR_8 195..255 CDD:290566 14/60 (23%)
leucine-rich repeat 197..220 CDD:275380 3/23 (13%)
leucine-rich repeat 221..244 CDD:275380 6/23 (26%)
leucine-rich repeat 245..268 CDD:275380 11/23 (48%)
LRRCT 277..327 CDD:214507 13/57 (23%)
IG_like 338..429 CDD:214653 18/121 (15%)
Ig 346..426 CDD:143165 16/110 (15%)
Islr2NP_001155007.1 leucine-rich repeat 80..96 CDD:275380 4/16 (25%)
LRR_8 96..155 CDD:290566 20/61 (33%)
leucine-rich repeat 97..120 CDD:275380 7/25 (28%)
leucine-rich repeat 121..144 CDD:275380 4/23 (17%)
LRR_4 144..183 CDD:289563 15/63 (24%)
leucine-rich repeat 145..168 CDD:275380 12/47 (26%)
LRR_8 164..227 CDD:290566 23/81 (28%)
LRR_4 169..208 CDD:289563 13/39 (33%)
leucine-rich repeat 169..192 CDD:275380 6/23 (26%)
leucine-rich repeat 193..216 CDD:275380 11/23 (48%)
LRRCT 225..273 CDD:214507 13/56 (23%)
Ig_2 288..417 CDD:290606 23/155 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24366
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.