DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kek1 and Lingo1

Sequence 1:NP_001303320.1 Gene:kek1 FlyBaseID:FBgn0015399 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_001094192.1 Gene:Lingo1 RGDID:1308668 Length:620 Species:Rattus norvegicus

Alignment Length:494 Identity:110/495 (22%)
Similarity:165/495 (33%) Gaps:175/495 (35%)


  Fly    90 CQTVCACKWKGGKQTVECIDRHLIQIPEHIDPNTQVLDMSGNKLQTLS---------------NE 139
            |...|.|  ....:.|.|..:..:.:||.|...|::||:..|:::||:               ||
  Rat    42 CPPRCEC--SAQDRAVLCHRKRFVAVPEGIPTETRLLDLGKNRIKTLNQDEFASFPHLEELELNE 104

  Fly   140 QFIRA-------NLLNLQKLYLRNCKIGEIERETFKGLTNLVELDLSHNLLV------------- 184
            ..:.|       ||.||:.|.||:.::..|....|.||:||.:||:|.|.:|             
  Rat   105 NIVSAVEPGAFNNLFNLRTLGLRSNRLKLIPLGVFTGLSNLTKLDISENKIVILLDYMFQDLYNL 169

  Fly   185 -----------------------------------TVPSLALGHIPSLRELTLASNHIHKIESQA 214
                                               ::|:.||.|:..|..|.|...:|:.|...:
  Rat   170 KSLEVGDNDLVYISHRAFSGLNSLEQLTLEKCNLTSIPTEALSHLHGLIVLRLRHLNINAIRDYS 234

  Fly   215 FGN------------------TP------SLHKLDLSHC-------------------------- 229
            |..                  ||      :|..|.::||                          
  Rat   235 FKRLYRLKVLEISHWPYLDTMTPNCLYGLNLTSLSITHCNLTAVPYLAVRHLVYLRFLNLSYNPI 299

  Fly   230 ---------------DIQTISAQ-------AFGGLQGLTLLRLNGNKLSELLPKTIETLSRLHGI 272
                           :||.:..|       ||.||..|.:|.::||:|:.|......::..|..:
  Rat   300 GTIEGSMLHELLRLQEIQLVGGQLAVVEPYAFRGLNYLRVLNVSGNQLTTLEESAFHSVGNLETL 364

  Fly   273 ELHDNPWLCDCRLRDTKLWLMKRNIPYPV---APVCSGGPERIIDRSFAD----LHVDEFACRPE 330
            .|..||..|||||    ||:.:|......   .|.|: .||.:..:.|.|    |..:.|.||..
  Rat   365 ILDSNPLACDCRL----LWVFRRRWRLNFNRQQPTCA-TPEFVQGKEFKDFPDVLLPNYFTCRRA 424

  Fly   331 ML--PISHYVEAAMGENASITCRARAVPAANINWYWNGRLLA---NNSAFTAYQRIHMLEQVEGG 390
            .:  ..:..|....|......|||...|...|.|....:.|.   :|...|.:.        :|.
  Rat   425 HIRDRKAQQVFVDEGHTVQFVCRADGDPPPAILWLSPRKHLVSAKSNGRLTVFP--------DGT 481

  Fly   391 FEKRSKLVLTNAQETDSSEFYCVAENRAGMAEANFTLHV 429
            .|.|      .||..|:..:.|:|.|..|.......|||
  Rat   482 LEVR------YAQVQDNGTYLCIAANAGGNDSMPAHLHV 514

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kek1NP_001303320.1 leucine-rich repeat 103..122 CDD:275380 5/19 (26%)
LRR_RI <119..277 CDD:238064 59/300 (20%)
leucine-rich repeat 123..148 CDD:275380 11/47 (23%)
LRR_8 148..207 CDD:290566 23/107 (21%)
leucine-rich repeat 149..172 CDD:275380 8/23 (35%)
leucine-rich repeat 173..196 CDD:275380 10/71 (14%)
LRR_8 195..255 CDD:290566 23/132 (17%)
leucine-rich repeat 197..220 CDD:275380 8/47 (17%)
leucine-rich repeat 221..244 CDD:275380 11/71 (15%)
leucine-rich repeat 245..268 CDD:275380 6/23 (26%)
LRRCT 277..327 CDD:214507 18/57 (32%)
IG_like 338..429 CDD:214653 23/94 (24%)
Ig 346..426 CDD:143165 19/83 (23%)
Lingo1NP_001094192.1 LRR <66..371 CDD:227223 63/305 (21%)
leucine-rich repeat 73..96 CDD:275380 6/23 (26%)
leucine-rich repeat 97..120 CDD:275380 5/23 (22%)
leucine-rich repeat 121..144 CDD:275380 8/23 (35%)
leucine-rich repeat 145..192 CDD:275380 6/47 (13%)
leucine-rich repeat 193..216 CDD:275380 4/23 (17%)
leucine-rich repeat 217..264 CDD:275380 8/47 (17%)
leucine-rich repeat 265..288 CDD:275380 4/23 (17%)
leucine-rich repeat 289..312 CDD:275380 0/23 (0%)
leucine-rich repeat 313..336 CDD:275380 7/23 (30%)
leucine-rich repeat 337..357 CDD:275380 6/20 (30%)
PCC 341..>421 CDD:188093 24/85 (28%)
Ig 439..514 CDD:325142 22/89 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T131073
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.