DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek1 and Lingo1

DIOPT Version :10

Sequence 1:NP_523559.3 Gene:kek1 / 34688 FlyBaseID:FBgn0015399 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_001094192.1 Gene:Lingo1 / 315691 RGDID:1308668 Length:620 Species:Rattus norvegicus


Alignment Length:494 Identity:110/494 - (22%)
Similarity:165/494 - (33%) Gaps:175/494 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 CQTVCACKWKGGKQTVECIDRHLIQIPEHIDPNTQVLDMSGNKLQTLS---------------NE 139
            |...|.|  ....:.|.|..:..:.:||.|...|::||:..|:::||:               ||
  Rat    42 CPPRCEC--SAQDRAVLCHRKRFVAVPEGIPTETRLLDLGKNRIKTLNQDEFASFPHLEELELNE 104

  Fly   140 QFIRA-------NLLNLQKLYLRNCKIGEIERETFKGLTNLVELDLSHNLLV------------- 184
            ..:.|       ||.||:.|.||:.::..|....|.||:||.:||:|.|.:|             
  Rat   105 NIVSAVEPGAFNNLFNLRTLGLRSNRLKLIPLGVFTGLSNLTKLDISENKIVILLDYMFQDLYNL 169

  Fly   185 -----------------------------------TVPSLALGHIPSLRELTLASNHIHKIESQA 214
                                               ::|:.||.|:..|..|.|...:|:.|...:
  Rat   170 KSLEVGDNDLVYISHRAFSGLNSLEQLTLEKCNLTSIPTEALSHLHGLIVLRLRHLNINAIRDYS 234

  Fly   215 FGN------------------TP------SLHKLDLSHC-------------------------- 229
            |..                  ||      :|..|.::||                          
  Rat   235 FKRLYRLKVLEISHWPYLDTMTPNCLYGLNLTSLSITHCNLTAVPYLAVRHLVYLRFLNLSYNPI 299

  Fly   230 ---------------DIQTISAQ-------AFGGLQGLTLLRLNGNKLSELLPKTIETLSRLHGI 272
                           :||.:..|       ||.||..|.:|.::||:|:.|......::..|..:
  Rat   300 GTIEGSMLHELLRLQEIQLVGGQLAVVEPYAFRGLNYLRVLNVSGNQLTTLEESAFHSVGNLETL 364

  Fly   273 ELHDNPWLCDCRLRDTKLWLMKRNIPYPV---APVCSGGPERIIDRSFAD----LHVDEFACRPE 330
            .|..||..|||||    ||:.:|......   .|.|: .||.:..:.|.|    |..:.|.||..
  Rat   365 ILDSNPLACDCRL----LWVFRRRWRLNFNRQQPTCA-TPEFVQGKEFKDFPDVLLPNYFTCRRA 424

  Fly   331 ML--PISHYVEAAMGENASITCRARAVPAANINWYWNGRLLA---NNSAFTAYQRIHMLEQVEGG 390
            .:  ..:..|....|......|||...|...|.|....:.|.   :|...|.:.        :|.
  Rat   425 HIRDRKAQQVFVDEGHTVQFVCRADGDPPPAILWLSPRKHLVSAKSNGRLTVFP--------DGT 481

  Fly   391 FEKRSKLVLTNAQETDSSEFYCVAENRAGMAEANFTLHV 429
            .|.|      .||..|:..:.|:|.|..|.......|||
  Rat   482 LEVR------YAQVQDNGTYLCIAANAGGNDSMPAHLHV 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek1NP_523559.3 leucine-rich repeat 103..122 CDD:275380 5/18 (28%)
LRR <122..>277 CDD:443914 58/296 (20%)
leucine-rich repeat 123..148 CDD:275380 11/46 (24%)
leucine-rich repeat 149..172 CDD:275380 8/22 (36%)
leucine-rich repeat 173..196 CDD:275380 10/70 (14%)
leucine-rich repeat 197..220 CDD:275380 8/46 (17%)
leucine-rich repeat 221..244 CDD:275380 11/70 (16%)
leucine-rich repeat 245..268 CDD:275380 6/22 (27%)
LRRCT 277..327 CDD:214507 18/56 (32%)
IG_like 338..429 CDD:214653 22/93 (24%)
Ig strand B 346..350 CDD:409353 0/3 (0%)
Ig strand C 359..363 CDD:409353 1/3 (33%)
Ig strand E 395..399 CDD:409353 0/3 (0%)
Ig strand F 409..414 CDD:409353 1/4 (25%)
Ig strand G 422..425 CDD:409353 0/2 (0%)
Lingo1NP_001094192.1 LRRNT 41..75 CDD:214470 9/34 (26%)
LRR 71..>371 CDD:443914 59/299 (20%)
leucine-rich repeat 73..96 CDD:275380 6/22 (27%)
leucine-rich repeat 97..120 CDD:275380 5/22 (23%)
leucine-rich repeat 121..144 CDD:275380 8/22 (36%)
leucine-rich repeat 145..192 CDD:275380 6/46 (13%)
leucine-rich repeat 193..216 CDD:275380 4/22 (18%)
leucine-rich repeat 217..264 CDD:275380 8/46 (17%)
leucine-rich repeat 265..288 CDD:275380 4/22 (18%)
leucine-rich repeat 289..312 CDD:275380 0/22 (0%)
leucine-rich repeat 313..336 CDD:275380 7/22 (32%)
leucine-rich repeat 337..357 CDD:275380 6/19 (32%)
PCC 341..>421 CDD:188093 24/84 (29%)
IgI_Lingo-1 423..514 CDD:409561 22/104 (21%)
Ig strand A 423..426 CDD:409561 0/2 (0%)
Ig strand A' 431..435 CDD:409561 0/3 (0%)
Ig strand B 441..450 CDD:409561 3/8 (38%)
Ig strand C 455..460 CDD:409561 2/4 (50%)
Ig strand C' 463..465 CDD:409561 0/1 (0%)
Ig strand D 474..477 CDD:409561 1/2 (50%)
Ig strand E 480..487 CDD:409561 3/12 (25%)
Ig strand F 493..501 CDD:409561 2/7 (29%)
Ig strand G 504..514 CDD:409561 2/9 (22%)

Return to query results.
Submit another query.