DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kek1 and Lrrc4b

Sequence 1:NP_001303320.1 Gene:kek1 FlyBaseID:FBgn0015399 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_937893.1 Gene:Lrrc4b MGIID:3027390 Length:709 Species:Mus musculus

Alignment Length:845 Identity:173/846 (20%)
Similarity:252/846 (30%) Gaps:336/846 (40%)


  Fly    82 PPAQQQSTCQTVCACKWKGGKQTVECIDRHLIQIPEHIDPNTQVLDMSGNKLQTLSNEQFIRANL 146
            |||   ::|...|:|..:..:  |.|..|.|.::|..|..||:.|::..|.:|.:..:.|  .:|
Mouse    54 PPA---TSCPAACSCSNQASR--VICTRRELAEVPASIPVNTRYLNLQENSIQVIRTDTF--KHL 111

  Fly   147 LNLQKLYLRNCKIGEIERETFKGLTNLVELDLSHNLLVTVPSLALGHIPSLRELTLASNHIHKIE 211
            .:|:.|.|....:.:||...|.||.:|..|:|..|.|.|||:.|..::..||||.|.:|.|..|.
Mouse   112 RHLEILQLSKNLVRKIEVGAFNGLPSLNTLELFDNRLTTVPTQAFEYLSKLRELWLRNNPIESIP 176

  Fly   212 SQAFGNTPSLHKLDLS------------------------------------------------- 227
            |.||...|||.:|||.                                                 
Mouse   177 SYAFNRVPSLRRLDLGELKRLEYISEAAFEGLVNLRYLNLGMCNLKDIPNLTALVRLEELELSGN 241

  Fly   228 ----------------------HCDIQTISAQAFGGLQGLTLLRLNGNKLSELLPKTIETLSRLH 270
                                  |..:.||...||..|:.|..|.|:.|.|..|.......|.||.
Mouse   242 RLDLIRPGSFQGLTSLRKLWLMHAQVATIERNAFDDLKSLEELNLSHNNLMSLPHDLFTPLHRLE 306

  Fly   271 GIELHDNPWLCDCRLRDTKLWL---MKRNIPYPVAPVCS--GGPERIIDRSFADLHVDEFAC-RP 329
            .:.|:.|||.|:|.:    |||   :|..:|.... .|:  ..|..:..|...:|....|.| .|
Mouse   307 RVHLNHNPWHCNCDV----LWLSWWLKETVPSNTT-CCARCHAPAGLKGRYIGELDQSHFTCYAP 366

  Fly   330 EMLPISHYVEAAMGENASITCRARAVPAANINWYW-NGRLLANNSAFTAYQ-RIHMLEQVEGGFE 392
            .::.....:....|..|.:.||. .....::||.. ||.|:.:.|    |: ||.:|..      
Mouse   367 VIVEPPTDLNVTEGMAAELKCRT-GTSMTSVNWLTPNGTLMTHGS----YRVRISVLHD------ 420

  Fly   393 KRSKLVLTNAQETDSSEFYCVAENRAGMAEANFTLHVS----MRAAGMASLGSGQIVGLSAALVA 453
              ..|..||....|:.::.|:..|.||...|:.||:||    :.|.|....|.|           
Mouse   421 --GTLNFTNVTVQDTGQYTCMVTNSAGNTTASATLNVSAVDPVAAGGPGGGGPG----------- 472

  Fly   454 LIVFALGVIMCLLLRVKRQPYVDSKTPNHMEVITSVNHQNSITNKTQPATGNGSIGGVVIANGAV 518
                                                              |.|..||.       
Mouse   473 --------------------------------------------------GGGGAGGA------- 480

  Fly   519 ANIIDGG-----VVQGGTLERKSSGRGGVPHGVHDQRSANPVQKPPRLTDLPYSTQGYDNNGSVL 578
                 ||     .|...|||.:.......|.|..        ::||                   
Mouse   481 -----GGYTYFTTVTVETLETQPGEEAQQPRGTE--------KEPP------------------- 513

  Fly   579 STASCFISPSGSTGNGGNNPDLINDTKRFGSDEFADLKIPPISGVGVGGSGEYSRANGCDSLYPS 643
                   .|:.....||..||.                                           
Mouse   514 -------GPTTDGAWGGGRPDA------------------------------------------- 528

  Fly   644 GLWEHGAPV-GTTSADDLFMKRYTDK---TPIIDSTQ--LYDLHERTAATD-----YFSKTFPRS 697
                 .||. .:|:|......|.|:|   .||.|.|:  |.||.:....|.     :.:.||..:
Mouse   529 -----AAPASASTTAPAPRSSRPTEKAFTVPITDVTENALKDLDDVMKTTKIIIGCFVAITFMAA 588

  Fly   698 HL--------QQGMMTGGGGGTSTASTVTTN----------------LSGGSSSGYPNDYGLPLV 738
            .:        :|..:....|.|.|...:...                ::||:..|..:...||.:
Mouse   589 VMLVAFYKLRKQHQLHKHHGPTRTVEIINVEDELPAASAVSVAAAAAVAGGAGVGGDSHLALPAL 653

  Fly   739 PGAEHQHNHQLQMHPLQQLQQQLTSTLNHQKQEGSSTGSSPHFSSRTLPRLHEGSGGGGSSRSSP 803
               |..|                   |||.           |:.:......:.|:.|||.....|
Mouse   654 ---ERDH-------------------LNHH-----------HYVAAAFKAHYGGNPGGGCGAKGP 685

  Fly   804  803
            Mouse   686  685

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kek1NP_001303320.1 leucine-rich repeat 103..122 CDD:275380 6/19 (32%)
LRR_RI <119..277 CDD:238064 58/229 (25%)
leucine-rich repeat 123..148 CDD:275380 6/25 (24%)
LRR_8 148..207 CDD:290566 23/59 (39%)
leucine-rich repeat 149..172 CDD:275380 8/23 (35%)
leucine-rich repeat 173..196 CDD:275380 9/23 (39%)
LRR_8 195..255 CDD:290566 27/131 (21%)
leucine-rich repeat 197..220 CDD:275380 12/23 (52%)
leucine-rich repeat 221..244 CDD:275380 10/94 (11%)
leucine-rich repeat 245..268 CDD:275380 7/23 (30%)
LRRCT 277..327 CDD:214507 15/55 (27%)
IG_like 338..429 CDD:214653 25/93 (27%)
Ig 346..426 CDD:143165 22/82 (27%)
Lrrc4bNP_937893.1 LRRNT 59..92 CDD:214470 11/35 (31%)
LRR <89..299 CDD:227223 53/212 (25%)
LRR 1 89..110 6/23 (26%)
leucine-rich repeat 90..113 CDD:275380 6/25 (24%)
LRR 2 113..134 6/21 (29%)
leucine-rich repeat 114..137 CDD:275380 8/23 (35%)
LRR 3 137..158 9/21 (43%)
leucine-rich repeat 138..161 CDD:275380 9/23 (39%)
LRR 4 161..182 11/21 (52%)
leucine-rich repeat 162..185 CDD:275380 12/23 (52%)
LRR 5 185..207 5/22 (23%)
leucine-rich repeat 186..210 CDD:275380 4/24 (17%)
LRR 6 210..231 0/21 (0%)
leucine-rich repeat 211..232 CDD:275380 0/21 (0%)
LRR 7 232..253 0/21 (0%)
leucine-rich repeat 233..256 CDD:275380 0/23 (0%)
LRR 8 256..277 5/21 (24%)
leucine-rich repeat 257..280 CDD:275380 6/23 (26%)
LRR 9 280..301 6/21 (29%)
leucine-rich repeat 281..302 CDD:275380 6/21 (29%)
LRRCT 313..363 CDD:214507 15/55 (27%)
I-set 366..455 CDD:336764 26/102 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T130835
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.