DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kek1 and Lrfn5

Sequence 1:NP_001303320.1 Gene:kek1 FlyBaseID:FBgn0015399 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_848829.2 Gene:Lrfn5 MGIID:2144814 Length:746 Species:Mus musculus

Alignment Length:877 Identity:170/878 (19%)
Similarity:285/878 (32%) Gaps:286/878 (33%)


  Fly    84 AQQQSTCQTVCACKWKGGKQTVECIDRHLIQIPEHIDPNTQVLDMSGNKLQTLSNEQFIR----- 143
            |.:...|...|.|:.........|..:.|:.:|.:||..|..|.::.|.:..:..:.|..     
Mouse    14 AVRAQICPKRCVCQILSPNLATLCAKKGLLFVPPNIDRRTVELRLADNFVTNIKRKDFANMTSLV 78

  Fly   144 -----------------ANLLNLQKLYLRNCKIGEIERETFKGLTNLVELDLSHNLLVTVPSLAL 191
                             |:|.||:.|:|.:.::.:|..:.|.||:||..|.|::|.|..:.|.|.
Mouse    79 DLTLSRNTISFITPHAFADLRNLRALHLNSNRLTKITNDMFSGLSNLHHLILNNNQLTLISSTAF 143

  Fly   192 GHIPSLRELTLASNHIHKIESQAFGNTPSLHKLDLSHCDIQTISAQAFGGLQGLTLLRLNGNKLS 256
            ..:.:|.||.|:.|::..|...|.....|||.|.|.|..|..|....|..|..:|.|.:..|||.
Mouse   144 DDVFALEELDLSYNNLETIPWDAVEKMVSLHTLSLDHNMIDNIPKGTFSHLHKMTRLDVTSNKLQ 208

  Fly   257 ELLPKTIETLSRL-----------HGIELHDNPWLCDCRLRDTKLWLMKRNIPYPVAPVCSGGPE 310
            :|.|..:...:::           ..:....||..|:|.|    |||.:.:....:....|  |.
Mouse   209 KLPPDPLFQRAQVLATSGIISPSTFALSFGGNPLHCNCEL----LWLRRLSREDDLETCAS--PA 267

  Fly   311 RIIDRSFADLHVDEFACRPEMLP-ISHYVEAAMGENASITCRARAVPAANINWYW-NGRLLANNS 373
            .:..|.|..:..:||.|.|.::. .:|.:....|:.|::.|:||..|...|:|.. .|:|::|.:
Mouse   268 LLTGRYFWSIPEEEFLCEPPLITRHTHEMRVLEGQRATLRCKARGDPEPAIHWISPEGKLISNAT 332

  Fly   374 AFTAYQRIHMLEQVEGGFEKRSKLVLTNAQETDSSEFYCVAENRAGMAEANFTLHVSMRAAGMAS 438
            ....|.        .|..:    :::|..::|.:  |.|:|.|.||.|.....||:         
Mouse   333 RSLVYD--------NGTLD----ILITTVKDTGA--FTCIASNPAGEATQTVDLHI--------- 374

  Fly   439 LGSGQIVGLSAALVALIVFALGVIMCLLLRVKRQPYVDSKTPNHMEVITSVNH-------QNSIT 496
                                                  .|.|:   ::.|.||       .:.|:
Mouse   375 --------------------------------------IKLPH---LLNSTNHIHEPDPGSSDIS 398

  Fly   497 NKTQPATGNGSIGG--------VVIANGAVANIIDGGVVQGGTLERKSSGRGGVPHGVHDQRSAN 553
            ..|:..:...|..|        :|:|...           ..|...|.:.:..:| |:       
Mouse   399 TSTKSGSNASSSNGDTKMSQDKIVVAEAT-----------SSTALLKFNFQRNIP-GI------- 444

  Fly   554 PVQKPPRLTDLPYSTQGYDNNGSVLSTASCFISPSGSTGNGGNNPDLINDTKRFGSDEFADLKIP 618
                  |:..:.|       ||:.                               .|......||
Mouse   445 ------RMFQIQY-------NGTY-------------------------------DDTLVYRMIP 465

  Fly   619 PISGVGVGGSGEYSRANGCDSLYPSGLWEHGAPVGTTSADDLFMKRYTDKTPIIDSTQLYDLHER 683
            |.|...:..    :.|:|                  |..|...:..|.|....:.:|::....:.
Mouse   466 PTSKTFLVN----NLASG------------------TMYDLCVLAIYDDGITSLTATRVVGCIQF 508

  Fly   684 TAATDYFSKTFPRSHLQQGMMTGGG-----GGTSTASTV-----------TTNLSGGSSSGYPND 732
            |...||.     |.|..|....||.     ||...||.:           ..|.:|         
Mouse   509 TTEQDYV-----RCHFMQSQFLGGTMIIIIGGIIVASVLVFIIILMIRYKVCNNNG--------- 559

  Fly   733 YGLPLVPGAEHQHNHQLQMHPLQQLQQQLTSTLNHQKQEGSSTGSSPHFSSRTLPRLHEGSGGGG 797
                                     |.::|...|...|   :.|:.....|.|||:.......|.
Mouse   560 -------------------------QHKVTKVSNVYSQ---TNGAQMQGCSVTLPQSMSKQAMGH 596

  Fly   798 SSRSSPTPAVSGG--HANQAANPSTSSSSCSILP----NGQPINAKTIRVWQKGGVPVLPP---- 852
            ...:......|..  .:::..:...||::.|.||    :..|::.|..|  :.|..|...|    
Mouse   597 EENAQCCKVASDNAIQSSETCSSQDSSTTTSALPPTWTSSAPVSQKQKR--KTGTKPSAEPQSEA 659

  Fly   853 VTALKRALISSSRNS---------PDEGYQEG 875
            ||.::..  :::||:         |.:...||
Mouse   660 VTNVESQ--NTNRNNSTALQLASCPPDSVTEG 689

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kek1NP_001303320.1 leucine-rich repeat 103..122 CDD:275380 5/19 (26%)
LRR_RI <119..277 CDD:238064 48/191 (25%)
leucine-rich repeat 123..148 CDD:275380 6/47 (13%)
LRR_8 148..207 CDD:290566 21/59 (36%)
leucine-rich repeat 149..172 CDD:275380 7/23 (30%)
leucine-rich repeat 173..196 CDD:275380 7/23 (30%)
LRR_8 195..255 CDD:290566 21/60 (35%)
leucine-rich repeat 197..220 CDD:275380 7/23 (30%)
leucine-rich repeat 221..244 CDD:275380 9/23 (39%)
leucine-rich repeat 245..268 CDD:275380 7/23 (30%)
LRRCT 277..327 CDD:214507 14/50 (28%)
IG_like 338..429 CDD:214653 24/92 (26%)
Ig 346..426 CDD:143165 21/81 (26%)
Lrfn5NP_848829.2 LRR_RI 41..>207 CDD:238064 47/166 (28%)
LRR_8 51..111 CDD:290566 10/60 (17%)
LRR 1 52..73 4/21 (19%)
leucine-rich repeat 53..76 CDD:275380 4/23 (17%)
LRR 2 76..97 1/21 (5%)
leucine-rich repeat 77..100 CDD:275380 2/23 (9%)
LRR_8 99..159 CDD:290566 21/60 (35%)
LRR 3 100..121 6/21 (29%)
leucine-rich repeat 101..124 CDD:275380 7/23 (30%)
LRR 4 124..145 8/21 (38%)
leucine-rich repeat 125..148 CDD:275380 7/23 (30%)
LRR 5 148..169 7/21 (33%)
LRR_8 149..207 CDD:290566 21/58 (36%)
leucine-rich repeat 149..172 CDD:275380 7/23 (30%)
LRR 6 172..193 9/21 (43%)
leucine-rich repeat 173..196 CDD:275380 9/23 (39%)
LRR 7 196..217 7/21 (33%)
leucine-rich repeat 197..215 CDD:275380 7/18 (39%)
TPKR_C2 240..>272 CDD:301599 10/38 (26%)
I-set 287..374 CDD:254352 25/101 (25%)
Ig_2 301..374 CDD:143241 24/87 (28%)
fn3 421..494 CDD:278470 21/158 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R8450
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.