DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kek1 and waif2

Sequence 1:NP_001303320.1 Gene:kek1 FlyBaseID:FBgn0015399 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_001245160.1 Gene:waif2 ZFINID:ZDB-GENE-120209-3 Length:313 Species:Danio rerio

Alignment Length:218 Identity:67/219 (31%)
Similarity:97/219 (44%) Gaps:21/219 (10%)


  Fly    87 QSTCQTVCACKWKGGKQTVECIDRHLIQIPEHIDPNTQVLDMSGNKLQTLSNEQFIR--ANLLNL 149
            ::.|...|.|    ..::|.|.|...|::|..:...||:|.::...:..|....|..  .|..:|
Zfish     9 EAQCPFNCTC----FNRSVMCEDSDEIKLPLEVPRRTQILTLNNVNMSVLIERAFSANGTNAHSL 69

  Fly   150 QKLYLRNCKIGEIERETFKGLTNLVELDLSHNLLVTVPSLALGHIPSLRELTLA-------SNHI 207
            .:|.||:..|..|:...|.||..|..||||.|.|..|...|...:..||.|.|:       :|.:
Zfish    70 HELSLRDNNIQVIQSCAFCGLHRLHLLDLSRNRLEDVHPEAFSELNQLRNLNLSYTLTAAGANQL 134

  Fly   208 HKIESQAFGNTPSLHKLDLSHCDIQTISAQAFGGLQGLTLLRLNGNKLSELLPKTIETLS--RLH 270
                |.|..:..:|..||||...::||....||.. .||:|.|..|.::.|....:..||  |..
Zfish   135 ----SSALDSLSNLQILDLSGNRLKTIPLSGFGKF-SLTMLNLTHNSITTLDTNELTKLSEYREM 194

  Fly   271 GIELHDNPWLCDC-RLRDTKLWL 292
            .:.|..||:.|.| |||:...||
Zfish   195 RVYLSHNPFDCRCDRLREFHDWL 217

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kek1NP_001303320.1 leucine-rich repeat 103..122 CDD:275380 5/19 (26%)
LRR_RI <119..277 CDD:238064 50/169 (30%)
leucine-rich repeat 123..148 CDD:275380 6/27 (22%)
LRR_8 148..207 CDD:290566 23/66 (35%)
leucine-rich repeat 149..172 CDD:275380 9/23 (39%)
leucine-rich repeat 173..196 CDD:275380 9/23 (39%)
LRR_8 195..255 CDD:290566 21/67 (31%)
leucine-rich repeat 197..220 CDD:275380 7/30 (23%)
leucine-rich repeat 221..244 CDD:275380 9/23 (39%)
leucine-rich repeat 245..268 CDD:275380 8/25 (32%)
LRRCT 277..327 CDD:214507 9/18 (50%)
IG_like 338..429 CDD:214653
Ig 346..426 CDD:143165
waif2NP_001245160.1 LRRNT 11..42 CDD:214470 9/35 (26%)
leucine-rich repeat 42..68 CDD:275380 5/26 (19%)
LRR_RI <68..156 CDD:238064 30/92 (33%)
LRR_8 68..126 CDD:290566 22/58 (38%)
leucine-rich repeat 69..92 CDD:275380 9/23 (39%)
leucine-rich repeat 93..116 CDD:275380 9/23 (39%)
leucine-rich repeat 117..143 CDD:275380 7/30 (23%)
LRR_8 142..203 CDD:290566 21/62 (34%)
LRR_4 143..182 CDD:289563 15/40 (38%)
leucine-rich repeat 144..166 CDD:275380 9/23 (39%)
leucine-rich repeat 167..190 CDD:275380 8/23 (35%)
TPKR_C2 201..246 CDD:301599 9/18 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24366
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.