DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pih1D1 and F32D8.4

DIOPT Version :9

Sequence 1:NP_723771.4 Gene:Pih1D1 / 34685 FlyBaseID:FBgn0032455 Length:1094 Species:Drosophila melanogaster
Sequence 2:NP_505775.3 Gene:F32D8.4 / 259646 WormBaseID:WBGene00009329 Length:291 Species:Caenorhabditis elegans


Alignment Length:95 Identity:28/95 - (29%)
Similarity:37/95 - (38%) Gaps:8/95 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GNDNFRD-QNLRFVRNEFEDNINQYFGGADPEGS------GPQQKPPPRDSLIVQPTAANSELDN 67
            |||:..: :|..|.....:....:.|.|...|.|      |...|.|.|..|.:.||.....||.
 Worm   190 GNDDVAEMKNEMFGLKHIDGTRIRLFDGDRLEISMRCELNGEPIKDPRRLELQLNPTRCLVTLDK 254

  Fly    68 RRQFLRDLGASRVLANALAQRTFNVPKFNL 97
            .|. |.|.|....:..:.|:..||..||.|
 Worm   255 SRS-LYDFGLPFHINPSTAKSKFNHEKFTL 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pih1D1NP_723771.4 PHA02896 <406..620 CDD:165222
F32D8.4NP_505775.3 alpha-crystallin-Hsps_p23-like 4..168 CDD:381838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4356
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4625
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.