DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pih1D1 and F32D8.4

DIOPT Version :10

Sequence 1:NP_723771.4 Gene:Pih1D1 / 34685 FlyBaseID:FBgn0032455 Length:1094 Species:Drosophila melanogaster
Sequence 2:NP_505775.3 Gene:F32D8.4 / 259646 WormBaseID:WBGene00009329 Length:291 Species:Caenorhabditis elegans


Alignment Length:95 Identity:28/95 - (29%)
Similarity:37/95 - (38%) Gaps:8/95 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GNDNFRD-QNLRFVRNEFEDNINQYFGGADPEGS------GPQQKPPPRDSLIVQPTAANSELDN 67
            |||:..: :|..|.....:....:.|.|...|.|      |...|.|.|..|.:.||.....||.
 Worm   190 GNDDVAEMKNEMFGLKHIDGTRIRLFDGDRLEISMRCELNGEPIKDPRRLELQLNPTRCLVTLDK 254

  Fly    68 RRQFLRDLGASRVLANALAQRTFNVPKFNL 97
            .|. |.|.|....:..:.|:..||..||.|
 Worm   255 SRS-LYDFGLPFHINPSTAKSKFNHEKFTL 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pih1D1NP_723771.4 PTZ00441 <161..416 CDD:240420
Pox_A30L_A26L <406..620 CDD:452796
F32D8.4NP_505775.3 alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. 4..168 CDD:469641
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.