DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pdm2 and Pou6f2

Sequence 1:NP_001285877.1 Gene:pdm2 FlyBaseID:FBgn0004394 Length:893 Species:Drosophila melanogaster
Sequence 2:NP_778171.2 Gene:Pou6f2 MGIID:2443631 Length:691 Species:Mus musculus

Alignment Length:610 Identity:150/611 (25%)
Similarity:232/611 (38%) Gaps:179/611 (29%)


  Fly   326 QLKHQQLRDVEEVLQEQEQDEEQEHETLRKP---HVVPSELEHNHHWHGVVCDANGHATRLLHIA 387
            ||:..||:..::..|:|:|.::|:.:....|   |..|:..                       |
Mouse   173 QLQQLQLQQQQQQQQQQQQQQQQQQQPPPPPTSQHPQPASQ-----------------------A 214

  Fly   388 PPRAGPTPLPTHQQPPVGEVLPPNSTSFSTIVDPPKEPSIYEQPAPNGRHCRPANKVMRHMSNSP 452
            ||::.||  |.||.||..:.||.          ||.:.....||..:..|..|.|:.    .|.|
Mouse   215 PPQSQPT--PPHQPPPASQQLPA----------PPAQLQQATQPQQHQPHSHPQNQT----QNQP 263

  Fly   453 TPPSPLRSLSDCGKSFEEEELELGENCEMPQNLSSKRQARELDSELENEVLDLAPP-PKRLAEEQ 516
            :|.                     :....|....|......|.|       .|.|| |.:|.   
Mouse   264 SPT---------------------QQSSSPPQKPSPSPGHSLPS-------PLTPPNPLQLV--- 297

  Fly   517 EEEKVASVNPPQPVAFAPEEMHQALQLQLHSYIEMVRQLAPEA----------FPNPNLATQF-- 569
             ...:||.......|.......||....|.|...:..||...|          .|||..::|.  
Mouse   298 -NNPLASQAAAAAAAMGSIASSQAFGNALSSLQGVTGQLVTNAQGQIIGTIPLMPNPGPSSQAAS 361

  Fly   570 -------------LLQNSLQALAQFQALQQMKQQQREDPLPSYSTPLAKSPLRSPSLSPVPRHSK 621
                         ||.|     ||.|.:..:...|   .||..:|       :..:|||:    |
Mouse   362 GTQGLQVQPITPQLLTN-----AQGQIIATVIGNQ---ILPVINT-------QGITLSPI----K 407

  Fly   622 SQQRTPPNSMTANSLGMSSAV-----MTPNTPSMQQQPQLQQSTPKPTSGLTVASAMAKLEQSPE 681
            ..|:...:|.|  |:|.:...     :.....:....|..|.|:...:|..:.|.::.:|..:|:
Mouse   408 PGQQLHQSSQT--SVGQAGTQGNLLHLAHGQAATSHSPVRQASSSSSSSSSSSALSVGQLVSNPQ 470

  Fly   682 ------ETTDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTI------------- 727
                  :..:|||:.:|||.||.||:.||.||..||.|:....|..:||:.|             
Mouse   471 TAAGEVDGVNLEEIREFAKAFKIRRLSLGLTQTQVGQALSATEGPAYSQSAICRHTILRSHFFLP 535

  Fly   728 -----------------------SRFEALNLSFKNMCKLKPLLQKWLEDADSTVAKSGGGVFNIN 769
                                   :|||.|:::.|:..|:||:|::|:.:|:   |:...|:.|  
Mouse   536 QEAQENTIASSLTAKLNPGLLYPARFEKLDITPKSAQKIKPVLERWMAEAE---ARHRAGMQN-- 595

  Fly   770 TMTSTLSSTPESILGRRRKKRTSIETTVRTTLEKAFLMNCKPTSEEISQLSERLNMDKEVIRVWF 834
             :|..:.|.|    .::||:|||........|...|..|..|:.:|:::::|:||.|:||:||||
Mouse   596 -LTEFIGSEP----SKKRKRRTSFTPQALEILNAHFEKNTHPSGQEMTEIAEKLNYDREVVRVWF 655

  Fly   835 CNRRQKEKRINPSLDLDSPT-GTPL 858
            ||:||..|.....|....|| ..||
Mouse   656 CNKRQALKNTIKRLKQHEPTSAAPL 680

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pdm2NP_001285877.1 POU 691..755 CDD:197673 29/100 (29%)
Homeobox 789..842 CDD:278475 22/53 (42%)
Pou6f2NP_778171.2 Pou 477..586 CDD:304656 32/109 (29%)
Homeobox 610..663 CDD:278475 22/53 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3802
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.