DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pdm2 and pou5f3.1

Sequence 1:NP_001285877.1 Gene:pdm2 FlyBaseID:FBgn0004394 Length:893 Species:Drosophila melanogaster
Sequence 2:NP_001272403.1 Gene:pou5f3.1 XenbaseID:XB-GENE-923211 Length:445 Species:Xenopus tropicalis

Alignment Length:430 Identity:136/431 (32%)
Similarity:186/431 (43%) Gaps:130/431 (30%)


  Fly   508 PPKRLAEEQEEEKVASVNPP---QPVAFAPEEMHQALQLQLHSYIEMVRQLAPEAFPNPNLATQF 569
            |.|.|..|:|:|:..|.:|.   .|.|.||        ...||:             ||   :.|
 Frog    92 PFKGLKREREDEEAKSESPEPKCSPPAAAP--------YYTHSW-------------NP---SSF 132

  Fly   570 LLQNSLQALAQFQALQQMKQQQREDPLPSYSTPLAKSPLRSPSLSPVPRHSKSQ----------- 623
            ..|.|                       |..|.:|..|:      |:|..|..:           
 Frog   133 WSQVS-----------------------SSGTTIASKPI------PIPHQSGDKCDPAGANSIFP 168

  Fly   624 -QRTPPNSMTANSLGMSSAVMTPNTPSMQQQPQLQQSTPKPTS-----GLTVASAMAKLEQSPEE 682
             .::|..|..:....:.::..:..|.|......|  .||:..|     ||:        ..|.||
 Frog   169 SDQSPDKSAESGISSLETSRCSSATSSSSGGTNL--GTPRSLSRGASDGLS--------SDSEEE 223

  Fly   683 TTDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLL 747
            ..:..|:|||||..|.:||.:|:||.|||.|:|.|:|..||||||.|||:|.|||||||||||||
 Frog   224 APNSGEMEQFAKDLKHKRITMGYTQADVGYALGVLFGKTFSQTTICRFESLQLSFKNMCKLKPLL 288

  Fly   748 QKWLEDADSTVAKSGGGVFNINTMTSTLSSTPESILGRRRKKRTSIETTVRTTLEKAFLMNCKPT 812
            :.||.:.::..        |:..:.|.....|:.   ::||.|||||..|:.|||..|:...||:
 Frog   289 RSWLHEVENNE--------NLQEIISRGQIIPQV---QKRKHRTSIENNVKRTLETYFMQCPKPS 342

  Fly   813 SEEISQLSERLNMDKEVIRVWFCNRRQKEKR--------------------INPS-----LDLDS 852
            ::||:|::..|||:|:|:||||||||||.||                    |.||     |....
 Frog   343 AQEIAQIARELNMEKDVVRVWFCNRRQKGKRQVYPYIRENGGEPYDAGQPLIPPSPGPFPLPQVM 407

  Fly   853 PTGTPLSSH-AFGYP--------PQALNMSHMQMEGGSGS 883
            |:..||..: |...|        |||  |.|....|..|:
 Frog   408 PSQVPLGPNPAIYLPTYHKNDMFPQA--MHHGIAMGNQGN 445

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pdm2NP_001285877.1 POU 691..755 CDD:197673 42/64 (66%)
Homeobox 789..842 CDD:278475 30/53 (57%)
pou5f3.1NP_001272403.1 POU 222..296 CDD:197673 46/74 (62%)
Homeobox 319..372 CDD:278475 30/53 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3802
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.