DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pdm2 and pou5f3.2

Sequence 1:NP_001285877.1 Gene:pdm2 FlyBaseID:FBgn0004394 Length:893 Species:Drosophila melanogaster
Sequence 2:NP_001123406.1 Gene:pou5f3.2 XenbaseID:XB-GENE-919841 Length:459 Species:Xenopus tropicalis

Alignment Length:421 Identity:130/422 (31%)
Similarity:189/422 (45%) Gaps:91/422 (22%)


  Fly   527 PQPVAFA-----PEEMHQALQ-----------------LQLHSYIEMVRQLAPEAFPNPNLATQF 569
            |||.:||     .|.....:|                 ...|..:|..:|..|...|:|   |..
 Frog    34 PQPFSFAFSTLKSENGDSGVQGMGDCSAPVMPWNSMASFDHHGQVETNQQGNPIRAPSP---TPT 95

  Fly   570 LLQNSLQALAQFQALQQMKQQQREDPLPSYSTP----------LAKSPL---------RSPSLSP 615
            |..:.::..   :.:........|.|.|.|.:|          ...||.         .|.|.:|
 Frog    96 LSDSRIKVK---EEVAHETDSGEESPEPKYPSPPNPSLYYPNTWTGSPFWQVNPTAGNNSNSTNP 157

  Fly   616 VPRHSKSQQRTPPNSMTANSLGMSSAVMTPNTP------SMQQQ----------PQLQQSTPKPT 664
            :|    ||......|:..|:...:.|..:||||      ||:..          ...:::|..|.
 Frog   158 MP----SQTLVKNGSLPGNTTYPTPANQSPNTPVDCVVSSMESSRCSSANSSNGAINERATTIPN 218

  Fly   665 SGLTVASAMAKLEQSPEETTDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISR 729
            .|:......:..|   ||.....|:|||||..|.:|:.:|:||.|||.|:|.|||..||||||.|
 Frog   219 GGMVDGGQSSDNE---EEVPSESEMEQFAKDLKHKRVSMGYTQADVGYALGVLYGKMFSQTTICR 280

  Fly   730 FEALNLSFKNMCKLKPLLQKWLEDADSTVAKSGGGVFNINTMTSTLSSTPESILGRRRKKRTSIE 794
            ||:|.|||||||:|||.|::||.:|:           |.:.:...::........|:||:||:||
 Frog   281 FESLQLSFKNMCQLKPFLERWLVEAE-----------NNDNLQELINREQVIAQTRKRKRRTNIE 334

  Fly   795 TTVRTTLEKAFLMNCKPTSEEISQLSERLNMDKEVIRVWFCNRRQKEKRIN-PSLDLDSPTG--- 855
            ..|:.|||..|:...||.::|:.|:::.|||||:|:||||||||||.||.. |::|.:...|   
 Frog   335 NIVKGTLESYFMKCSKPGAQEMVQIAKELNMDKDVVRVWFCNRRQKGKRQGMPTVDENDGEGYDV 399

  Fly   856 -----TPLSSHAFGYPPQALNMSHMQMEGGS 881
                 :|...| :..|....:..:|....||
 Frog   400 GQTMASPPVGH-YSLPQVVTSQGYMAAPLGS 429

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pdm2NP_001285877.1 POU 691..755 CDD:197673 41/64 (64%)
Homeobox 789..842 CDD:278475 29/53 (55%)
pou5f3.2NP_001123406.1 Pou 238..306 CDD:278582 43/68 (63%)
Homeobox 329..382 CDD:278475 29/53 (55%)
Mtc <378..>440 CDD:296347 14/54 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3802
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.