DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5421 and Atp6ap1

Sequence 1:NP_001260418.1 Gene:CG5421 FlyBaseID:FBgn0032434 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_113973.1 Gene:Atp6ap1 RGDID:620423 Length:463 Species:Rattus norvegicus

Alignment Length:361 Identity:68/362 (19%)
Similarity:120/362 (33%) Gaps:105/362 (29%)


  Fly   104 RVAEKTGDIIW-HIPKISEMGSLEAEMELPCQKGEIHAFSFNDRNLLA-----HD----AAMAVA 158
            |...:...::| .:..::...::.||.::|.      ....:||:|.|     |:    :.|.::
  Rat    11 RTGTRWAPVLWLLLSLVAVAAAVAAEQQVPL------VLWSSDRDLWAPVADTHEGHITSDMQLS 69

  Fly   159 TYQ--------------FSDCPVVHVYTAYTEEDKALQRRKSQKTQHMSIKNKIDGQPSNSDTEV 209
            ||.              ..|...:..:|||..                ...||.|...||.:..:
  Rat    70 TYLDPALELGPRNVLLFLQDKLSIEDFTAYGG----------------VFGNKQDSAFSNLENAL 118

  Fly   210 ELQPHQISQSQAD-----NMTVLRNEMIVLTFRSILLAT-KEQRSVLS---------PFNRTEVM 259
            :|.|..:.....|     .:|....|.:..:...:.||| ||.:...|         |:..:..:
  Rat   119 DLAPSSLVLPAVDWYAISTLTTYLQEKLGASPLHVDLATLKELKLNASLPALLLIRLPYTASSGL 183

  Fly   260 LAQGREPLQVGLLNSHDIFGGIVMVLNTELGPLIVELI---PSQ------------GNWYLTRMI 309
            :|    |.:| |..:.::.|.::..|.:|..|....|.   ||:            |...|...:
  Rat   184 MA----PREV-LTGNDEVIGQVLSTLESEDVPYTAALTAVRPSRVARDVAMVAGGLGRQLLQTQV 243

  Fly   310 FMNNTHYPRD-------LYFYGFEFSLCCTDITVYSSEASRLSFFDFHLDIL------WQDKDNG 361
            .....|.|..       :.|:...||:      .|..|...|:...|.::.|      |.|....
  Rat   244 ASPAIHPPVSYNDTAPRILFWAQNFSV------AYKDEWKDLTSLTFGVENLNLTGSFWNDSFAM 302

  Fly   362 LDLQYEVKPCWNCSILMTPTMAQTIFVVLIIAAILW 397
            |.|.||  |.:..::.....:|...:.|   :|..|
  Rat   303 LSLTYE--PLFGATVTFKFILASRFYPV---SARYW 333

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5421NP_001260418.1 None
Atp6ap1NP_113973.1 ATP-synt_S1 <414..442 CDD:283484
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001224
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12471
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.