DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5421 and Atp6ap1

Sequence 1:NP_001260418.1 Gene:CG5421 FlyBaseID:FBgn0032434 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_061264.1 Gene:Atp6ap1 MGIID:109629 Length:463 Species:Mus musculus

Alignment Length:368 Identity:71/369 (19%)
Similarity:123/369 (33%) Gaps:107/369 (29%)


  Fly   102 VERVAEKTG--DIIW-HIPKISEMGSLEAEMELPCQKGEIHAFSFNDRNLLA-----HD----AA 154
            |.|:...||  .::| .:..::...::..|.::|.      ....:||||.|     |:    :.
Mouse     7 VSRIRTGTGRAPVMWLSLSLVAVAAAVATEQQVPL------VLWSSDRNLWAPVADTHEGHITSD 65

  Fly   155 MAVATYQ--------------FSDCPVVHVYTAYTEEDKALQRRKSQKTQHMSIKNKIDGQPSNS 205
            |.::||.              ..|...:..:|||..                ...||.|...||.
Mouse    66 MQLSTYLDPALELGPRNVLLFLQDKLSIEDFTAYGG----------------VFGNKQDSAFSNL 114

  Fly   206 DTEVELQPHQISQSQAD-----NMTVLRNEMIVLTFRSILLAT-KEQRSVLS---------PFNR 255
            :..::|.|..:.....|     .:|....|.:..:...:.||| ||.:...|         |:..
Mouse   115 ENALDLAPSSLVLPAVDWYAISTLTTYLQEKLGASPLHVDLATLKELKLNASLPALLLIRLPYTA 179

  Fly   256 TEVMLAQGREPLQVGLLNSHDIFGGIVMVLNTELGPLIVELI---PSQ------------GNWYL 305
            :..::|    |.:| |..:.::.|.::..|.:|..|....|.   ||:            |...|
Mouse   180 SSGLMA----PREV-LTGNDEVIGQVLSTLKSEDVPYTAALTAVRPSRVARDITMVAGGLGRQLL 239

  Fly   306 TRMIFMNNTHYPRD-------LYFYGFEFSLCCTDITVYSSEASRLSFFDFHLDIL------WQD 357
            ...:.....|.|..       :.|:...||:      .|..|...|:...|.::.|      |.|
Mouse   240 QTQVASPAIHPPVSYNDTAPRILFWAQNFSV------AYKDEWKDLTSLTFGVENLNLTGSFWND 298

  Fly   358 KDNGLDLQYEVKPCWNCSILMTPTMAQTIFVVLIIAAILWMGL 400
            ....|.|.||  |.:..::.....:|...:.|   :|..|..:
Mouse   299 SFAMLSLTYE--PLFGATVTFKFILASRFYPV---SARYWFAM 336

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5421NP_001260418.1 None
Atp6ap1NP_061264.1 ATP-synt_S1 <414..442 CDD:283484
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3868
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001224
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12471
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.