DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5421 and Atp6ap1l

Sequence 1:NP_001260418.1 Gene:CG5421 FlyBaseID:FBgn0032434 Length:426 Species:Drosophila melanogaster
Sequence 2:XP_017446437.1 Gene:Atp6ap1l RGDID:1564936 Length:344 Species:Rattus norvegicus

Alignment Length:124 Identity:24/125 (19%)
Similarity:46/125 (37%) Gaps:32/125 (26%)


  Fly   299 SQGNWY---LTRMIFMNNTH--------YPRDLYFYGFE--FSLCCTDITVYSSEAS------RL 344
            |..:|:   ...:||.|:..        |....|.|..:  .||...|..:..|.:.      .:
  Rat   174 SSQSWFSLHRVEIIFNNSVQATFNATGIYALSTYSYHCQRVSSLRRNDALLLLSSSDDVTSLWEV 238

  Fly   345 SFFDFHLDILWQDKDNGLDLQ-YEVKPCWNCSILMTPT----MAQTIFVVLIIAAILWM 398
            :|.||.:        .|..:: .:.....:||...:|.    :|.::.::|::|..|.|
  Rat   239 TFIDFQI--------QGFSIKGAQFSQARDCSSSFSPAVLIGLAMSLILLLVLAYALHM 289



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3868
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001224
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12471
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.