| Sequence 1: | NP_001260418.1 | Gene: | CG5421 / 34661 | FlyBaseID: | FBgn0032434 | Length: | 426 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001036775.1 | Gene: | CG31030 / 318563 | FlyBaseID: | FBgn0051030 | Length: | 423 | Species: | Drosophila melanogaster |
| Alignment Length: | 449 | Identity: | 84/449 - (18%) |
|---|---|---|---|
| Similarity: | 156/449 - (34%) | Gaps: | 130/449 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1 MYFIASLLLIVPIAFGSAPVTSSPPVLVWGVDTPKATSIFQPVTTAQFRKIIRNLQKNNMIVIYL 65
Fly 66 ASELAAKDINCDLCFPYLTKIQPMNYYSQVEEPLNAVE-------RVAEKTGDIIW-HIPKIS-- 120
Fly 121 -EMGSLEAEMELPCQKGEIHAFSFNDRNLLAHDAAMAVATYQFSDCPVVHVYTAYTEEDKALQRR 184
Fly 185 KSQKTQHMSIKNKIDGQPSNSDTEVELQPHQISQSQADNMTVLRNEMIVLTFRSIL--------- 240
Fly 241 --------LATKEQRSVLSPFNRTEVMLAQGREPLQVGLLNSHDIFGGIVMVLNTELGPLIVELI 297
Fly 298 PSQGNWYLTRMIFMNNTHYPRDLYFYGFEFSLCCTDITV-YSSEASRLSFF-------------- 347
Fly 348 DFHLDILWQDKDNGLDLQYEVKPCWNCSILMTPTMAQTIFVVLIIAAILWMGLAILLSI 406 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG5421 | NP_001260418.1 | None | |||
| CG31030 | NP_001036775.1 | ATP-synt_S1 | 243..377 | CDD:310428 | 30/137 (22%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3868 | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR12471 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.910 | |||||