DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5421 and atp6ap1l

Sequence 1:NP_001260418.1 Gene:CG5421 FlyBaseID:FBgn0032434 Length:426 Species:Drosophila melanogaster
Sequence 2:XP_002935745.2 Gene:atp6ap1l XenbaseID:XB-GENE-6463386 Length:354 Species:Xenopus tropicalis

Alignment Length:201 Identity:38/202 (19%)
Similarity:63/202 (31%) Gaps:80/202 (40%)


  Fly   223 NMTVLRNEMIVLTFRSILLATKEQRSVLSPFNRTEVMLAQGREPLQVGLLNSHDIFGGIVMVLNT 287
            |...|.|..|:|           ..||.:.||.|.:....|..      .:.|.|         :
 Frog   179 NWFQLHNVQIIL-----------NNSVQATFNTTWISAPVGSS------FHCHHI---------S 217

  Fly   288 ELGPLIVELIPSQGN-----WYLTRMIFMNNTHYPRDLYFYGFEFSLCCTDITVYSSEASRLSFF 347
            .|......|:||.|:     |               ||.|..|:       |..:::|       
 Frog   218 SLKKYDALLVPSSGDGSTRLW---------------DLTFLNFQ-------IQAFNAE------- 253

  Fly   348 DFHLDILWQDKDNGLDLQYEVKPCWNCSILMTPTMAQTIFVVLIIAAILWMGLAILL---SIGQN 409
            |.|..                 ...:|:..|:|.:...:.:.||:..:|...|.:|:   ||.::
 Frog   254 DGHFG-----------------SARDCTTYMSPAILMGLVMSLILLLVLAYALHMLIHLKSIDKH 301

  Fly   410 QLMQNA 415
            ...:|:
 Frog   302 YQRKNS 307

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5421NP_001260418.1 None
atp6ap1lXP_002935745.2 Lamp <96..287 CDD:279622 33/180 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001224
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.