DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5421 and atp6ap1.2

Sequence 1:NP_001260418.1 Gene:CG5421 FlyBaseID:FBgn0032434 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001123842.1 Gene:atp6ap1.2 XenbaseID:XB-GENE-997187 Length:455 Species:Xenopus tropicalis

Alignment Length:504 Identity:102/505 (20%)
Similarity:176/505 (35%) Gaps:154/505 (30%)


  Fly     4 IASLLLIVPIAFGSAPVTSSPPVLVWGVDTPKATSIFQP-------VTTAQFRKII--------R 53
            :.|||.:|.: |.:|| :...|||:|..::....|  ||       .|..:.::.:        |
 Frog     6 LLSLLFLVGL-FPAAP-SQQVPVLLWSSESSVWNS--QPSIHSGHIATDTELQRYLGPALTKGPR 66

  Fly    54 NLQKNNMIVIYLASELAAKDINC---------DLCFPYLTKIQPMNYYSQVEEPLNAVERVA--- 106
            ||      :::...:|:.:|...         |..||.|..|...:..|.|   |.:|:..|   
 Frog    67 NL------LLFFQDKLSIEDFTAFAGVYGNKQDSAFPNLQSIVESSPSSLV---LPSVDWYAANM 122

  Fly   107 ------EKTGDIIWHIP-------KISEMGSLEAEMELP--CQKGEIHAFSFNDRNLLAHDAAM- 155
                  |:.|....|:.       |::|.......:.||  ...|.:.|...    |.|:|.|: 
 Frog   123 LPTYLKERLGVSPLHVDQSTLMELKLNETVPSLLVVRLPYGSSSGLLAAKDV----LRANDQAIG 183

  Fly   156 -AVATYQFSDCPVVHVYTAYTEEDKALQRRKSQKTQHMSIKN-----KIDGQPSNSDTEVELQPH 214
             .::|.:....|    |||..   .||:..:..|...:::.|     ....||:.|...|     
 Frog   184 QVLSTLKSEGVP----YTALL---TALRPSRVIKEASLAVGNLGRQLLATAQPTPSYPPV----- 236

  Fly   215 QISQSQADNMTVLRNEMIVLTFRSILLATKEQRSVLSPFNRTEVMLAQGREPLQVGLLNSHDIFG 279
                  |.|.:  ||...:|.:.:.:..|.:.         .:|.|..     |....::.|:.|
 Frog   237 ------AFNSS--RNTPCILFWATNVSVTVDD---------VQVDLTD-----QTFTASNLDLTG 279

  Fly   280 GIVMVLNTELGPLIVELIPSQGNWYLTRMIFMNNTHYPRDLYFYGFEFSLCCTDITVYSSEASRL 344
            .:...:|:.|.....|.:  :|| .||...|:|...||....|:   |:|...:| :||...:..
 Frog   280 SLCNDINSVLAITYKEAV--KGN-PLTLRFFLNRRFYPVSARFW---FTLSQVEI-IYSGNTATF 337

  Fly   345 --------SFFDFHLDIL----------------------WQ----------DKDNGLDLQYEVK 369
                    |.:.||...:                      ||          ....|:...|   
 Frog   338 LAPQVNAPSNYSFHCQYISSWPTFGSVLVSNTSKNSPASKWQLHIAEFQIQGFNVTGMAFSY--- 399

  Fly   370 PCWNCSILMTPTMAQTIFVVLIIAAILWMGLAILLSIGQNQLMQNANDP 418
             ..:|:...:|.:...:...|:...||..||.:::|:   :.|...:||
 Frog   400 -ASDCAGFFSPGIWMGLITTLLFVFILTYGLHMVMSL---KTMDRFDDP 444

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5421NP_001260418.1 None
atp6ap1.2NP_001123842.1 ATP-synt_S1 <126..242 CDD:283484 28/140 (20%)
ATP-synt_S1 <406..434 CDD:283484 6/28 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3868
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001224
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.