DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5421 and atp6ap1a

Sequence 1:NP_001260418.1 Gene:CG5421 FlyBaseID:FBgn0032434 Length:426 Species:Drosophila melanogaster
Sequence 2:XP_001339012.3 Gene:atp6ap1a ZFINID:ZDB-GENE-090312-136 Length:466 Species:Danio rerio

Alignment Length:303 Identity:58/304 (19%)
Similarity:104/304 (34%) Gaps:98/304 (32%)


  Fly   166 PVVHVYTA------YTEEDKALQRRKSQKTQHMSIKNKIDGQPSNSDTEVELQPHQISQSQADNM 224
            |...|:||      ..|...|:|...|:..    ::::.|..|:.:      .|.:..:..:..:
Zfish   201 PYTAVFTALWPSRVVEEASPAVQSVWSRSL----LQSRRDELPAPN------PPLEFKEKGSTCI 255

  Fly   225 TVLRNEMIVLTFRSILLATKEQRSVLSPFNRTEVMLAQGREPLQVG----------LLNSHDIFG 279
            .:...:::|..:||    .|.:|..|     |.....:|.||...|          :||..|:..
Zfish   256 LMWAEKLVVSQYRS----GKWERHDL-----TSQTFGKGVEPNLSGSSCNDTHSRLVLNYEDVLN 311

  Fly   280 ----GIVMVLNTELGPLIVELIPSQGNWYLTRMI----------FMNNTH-YPRDLYFYGFEFSL 329
                .:::|:|..      ....|..:|:...::          |..:.| |....|.|..|   
Zfish   312 FRSFKLLLVMNRR------HYKVSARHWFTMDLVQLEYDGKKASFNGSRHIYAPSEYSYRCE--- 367

  Fly   330 CCTDITVYSSEASRLSFFDFHLDILWQDKDN-------------------GLDLQYEVKPCWNCS 375
                 :|.||..::||        ...||||                   |.|..|    ..:|:
Zfish   368 -----SVSSSYYAQLS--------PHSDKDNANDWQISFENFQIQGFNVAGKDFSY----ASDCA 415

  Fly   376 ILMTPTMAQTIFVVLIIAAILWMGLAILLSIGQNQLMQNANDP 418
            ...||.:...:...|::..:|..||.:::   |.:.|...:||
Zfish   416 SFFTPGIWMGLVTSLLMVLVLTYGLHMIM---QLRTMDRFDDP 455

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5421NP_001260418.1 None
atp6ap1aXP_001339012.3 ATP-synt_S1 <365..444 CDD:283484 20/99 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3868
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001224
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12471
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.