DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: eRF3 and GSPT2

Sequence 1:NP_001260415.1 Gene:eRF3 FlyBaseID:FBgn0020443 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_060564.2 Gene:GSPT2 HGNCID:4622 Length:628 Species:Homo sapiens

Alignment Length:639 Identity:369/640 (58%)
Similarity:439/640 (69%) Gaps:71/640 (11%)


  Fly     1 MAAQENTEISTKFS-TLNVNAVEFVPSFSYNSVVNVAEEAAAVVVAAAAAEETADPGPASGSATP 64
            :|..:...:|:.|| .|||||..|||:      |:.||..               |....|...|
Human    36 VAEAQREPLSSAFSRKLNVNAKPFVPN------VHAAEFV---------------PSFLRGPTQP 79

  Fly    65 ATTPDSVGSGGST-AGAAPPPPTAQGAGA-AAPSAQPPTSSSNSASPAPGSPATTPSAGAAAADP 127
            .|.|...||...| .||..|.....|.|| ..||.:.|..|...::.|.....:.|         
Human    80 PTLPAGSGSNDETCTGAGYPQGKRMGRGAPVEPSREEPLVSLEGSNSAVTMELSEP--------- 135

  Fly   128 TPIDGLNPSDKIANNETDPA--DSWDVDDAVITPEDEEVEDAE---FTEGEATP----------- 176
                      .:.|.|.:.|  :||:        ..:||.:||   .:.|::.|           
Human   136 ----------VVENGEVEMALEESWE--------HSKEVSEAEPGGGSSGDSGPPEESGQEMMEE 182

  Fly   177 --KVSKKKVVKVEENRSKREHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSR 239
              ::.|.|.|.|.....|:|||||||||||||||||||||||.|||||||||||||||||:||:|
Human   183 KEEIRKSKSVIVPSGAPKKEHVNVVFIGHVDAGKSTIGGQIMFLTGMVDKRTLEKYEREAKEKNR 247

  Fly   240 ESWYLSWALDTNQEERDKGKTVEVGRAFFETDRKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 304
            |:|||||||||||||||||||||||||:|||:|||||||||||||||||||||||:|||||||||
Human   248 ETWYLSWALDTNQEERDKGKTVEVGRAYFETERKHFTILDAPGHKSFVPNMIGGASQADLAVLVI 312

  Fly   305 SARKGEFETGFDRGGQTREHAMLAKTAGVKHLVVLVNKMDDPTVNWDQTRYNECKDKILPYLKKL 369
            |||||||||||::|||||||||||||||||||:||:||||||||||...||.|||:|::|:|||:
Human   313 SARKGEFETGFEKGGQTREHAMLAKTAGVKHLIVLINKMDDPTVNWSIERYEECKEKLVPFLKKV 377

  Fly   370 GFNPAKDLTFMPCSGLSGYGLKDQIPETLCPWYRGPAFIPFIDELPSLNRKSDGPFIMPIVDKYK 434
            ||:|.||:.|||||||:|..:|:|  ...||||.|..|||::|.||:.||..|||..:|||||||
Human   378 GFSPKKDIHFMPCSGLTGANIKEQ--SDFCPWYTGLPFIPYLDNLPNFNRSIDGPIRLPIVDKYK 440

  Fly   435 DMGTVVMGKVESGTARKGQNLLVMPNRTQVAVDQLFSDDFEVTSVGPGENVKIKLKGIEEEDVSP 499
            ||||||:||:|||:..|||.|::|||:..|.|..:.|||.|...|.||||:||:|||||||::.|
Human   441 DMGTVVLGKLESGSIFKGQQLVMMPNKHNVEVLGILSDDTETDFVAPGENLKIRLKGIEEEEILP 505

  Fly   500 GFVLCDAANPIKTGKIFDAQVVILEHKSIICAGYSAVMHIHCAAEEVTVKALICLVDKKSGDKSK 564
            ||:|||.:|...:|:.||.|:||:|||||||.||:||:|||...|||.:.|||.|||||||:|||
Human   506 GFILCDPSNLCHSGRTFDVQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALISLVDKKSGEKSK 570

  Fly   565 TRPRFVKQDQVAIMRIECSGMICLEQFKLFPQMGRFTLRDENKTIAIGKVLKVV 618
            |||||||||||.|.|:..:|.||||.||.||||||||||||.||||||||||:|
Human   571 TRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLV 624

Known Domains:


GeneSequenceDomainRegion External IDIdentity
eRF3NP_001260415.1 PAM2 12..28 CDD:284542 10/17 (59%)
TEF1 191..619 CDD:227581 319/429 (74%)
EF1_alpha 197..416 CDD:206670 179/219 (82%)
eRF3_II 424..505 CDD:293906 51/81 (63%)
eRF3_C_III 511..617 CDD:294003 78/106 (74%)
GSPT2NP_060564.2 PAM2 47..64 CDD:284542 11/23 (48%)
TEF1 201..625 CDD:227581 318/427 (74%)
EF1_alpha 205..421 CDD:206670 178/218 (82%)
G1. {ECO:0000255|PROSITE-ProRule:PRU01059} 210..217 7/7 (100%)
G2. {ECO:0000255|PROSITE-ProRule:PRU01059} 266..270 4/4 (100%)
G3. {ECO:0000255|PROSITE-ProRule:PRU01059} 287..290 3/3 (100%)
G4. {ECO:0000255|PROSITE-ProRule:PRU01059} 349..352 3/3 (100%)
G5. {ECO:0000255|PROSITE-ProRule:PRU01059} 391..393 2/2 (100%)
eRF3_II 430..511 CDD:293906 51/81 (63%)
eRF3_C_III 517..623 CDD:294003 78/106 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5256
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 688 1.000 Inparanoid score I686
Isobase 1 0.950 0 Normalized mean entropy S365
OMA 1 1.010
OrthoDB 1 1.010 D1150082at2759
OrthoFinder 1 1.000 FOG0001822
OrthoInspector 1 1.000 T609854
orthoMCL 1 0.900 OOG5_127225
Panther 1 1.100 O PTHR23115
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1211.790

Return to query results.
Submit another query.