DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkd2 and Pkd1l2

DIOPT Version :8

Sequence 1:NP_609561.2 Gene:Pkd2 / 34651 FlyBaseID:FBgn0041195 Length:924 Species:Drosophila melanogaster
Sequence 2:NP_083962.4 Gene:Pkd1l2 / 76645 MGIID:2664668 Length:2461 Species:Mus musculus

Alignment Length:936 Identity:193/937 (21%)
Similarity:313/937 (33%) Gaps:298/937 (32%)


  Fly     5 GQSGRSPSGPPGPPPPRPP-----------------------KTPPGASPRGT------------ 34
            |:.||...|||...|...|                       |..|.||...:            
Mouse  1625 GKDGRQKQGPPNLTPSAQPTEEGLLTPETGIQSLISSLFKALKVQPPASGWDSMNPVDINYLLTL 1689

  Fly    35 ------PTADSTPGDVTPARGPPPPPATKRVSIGVGSTRSAPPPATDPTGPPPTAG--------- 84
                  |.:...||....|:|...|         :.|||.:..|..:...|.|...         
Mouse  1690 MEDIICPESTEGPGFWEEAKGREDP---------ITSTRGSVKPKENTWHPKPELAVRGLWKDSV 1745

  Fly    85 -------------KPVRDTGPS-----TSPRPSLR-----------DPGQSTSDKPSTSDKPSTS 120
                         :.::..||.     .|...:||           .||......|||| :.|.|
Mouse  1746 YRRCLYLQLEHVERELQLLGPQGFLHHHSHAQALRQLHVLKGHLWGQPGTPALAYPSTS-RVSKS 1809

  Fly   121 DK-----------------PSTSARTTV---REPGPSSS----PSRPVSTRESGRITFQEAAPST 161
            .:                 ...:|..|:   ...|..||    .|..||..||..||       .
Mouse  1810 PRGLPWWCVLVGWLLVATTSGVAAFFTMLYGLHYGRVSSLKWLISMAVSFVESVFIT-------Q 1867

  Fly   162 SAKVVKLAASEPRPAK-PPEKEGFSLFKRKKKSVG-----SSTPPSPSRGHRAPSIIAASALQNR 220
            ..||:..||......| ..::|...||.....|.|     .|...|..|.::.|.:.|.    .:
Mouse  1868 PLKVLGFAAFFALVLKREDDEETLPLFPGHLSSPGPGVLFRSRRHSSERAYQPPPMAAI----EK 1928

  Fly   221 AKTNRILYTTDEEVREALV-EFSVFIIFLILTSLVVLSVRHTYMFYFNDTMKKLFTNREMVVAPS 284
            .||.|:    .|:...||: |...::.||.:..||....|....::|:..:::.|:.        
Mouse  1929 MKTTRL----KEQKAFALIREILAYLAFLWMLLLVAYGQRDPNAYHFHRHLERSFSQ-------- 1981

  Fly   285 VTVGFEKLITVPDWWDYLKYNFLVTLHGDLTFMDDAQANLTSMPPEGSEQGSEQGSEQGSEQSPE 349
               ||..::....::::.....:..|:|                                 ..|.
Mouse  1982 ---GFSPVLGFRGFFEWANTTLVKNLYG---------------------------------HHPG 2010

  Fly   350 EVVGEAPEEAPEMDRLQEDFKYNGNPYIDLRGHRRAKRQSGVDGNSEDGSEDVSGNYLKDDSDSI 414
            .|                                       .||||:                  
Mouse  2011 FV---------------------------------------TDGNSK------------------ 2018

  Fly   415 QANMSFHHLEGRVFLYENLLLGPPRLRQIRVRKESCYVNDAFIRYFNTCYAAYSSGAEDRKPMHK 479
                               |:|...:||:|||:.||.|........:.|:..||.|.||.....:
Mouse  2019 -------------------LVGSAHIRQVRVRESSCAVAQQLQDSLDGCHGPYSLGIEDLVDYGE 2064

  Fly   480 G---SPFRTMHDLDST------------PIWTVLAFYRTGGYTVNLDYDKDRNVKIINDLKDIHW 529
            |   |.:...:.....            |:|..|..|..|||.|.|..|.....:|:..|.|..|
Mouse  2065 GWNASAYNNSNGFPQAWRYQSQSQRRGYPMWGKLTLYGGGGYVVPLGTDHQSASRILQYLFDNSW 2129

  Fly   530 LDRGSRLCLVEFNLFNENTDIFQSIKLIAEIPPTGGVIPQAHLQTVKMYSFFTDRSMLMTVIYIF 594
            ||..:|...|||.::|.|.::|.::.|..|....|.......||::::|.|.......:....:.
Mouse  2130 LDALTRAVFVEFTVYNANVNLFCTVTLTLETSGLGTFFSHVTLQSLRLYPFTDGWHPFVVAAELT 2194

  Fly   595 WYIMVIYYTIYEITEIRKS--GIKIYFCSMLNILDCAILLGCYLALVYNIWHSFKVMSLTA---- 653
            :::.:.||.:.:...:||.  |   ||||..|:|:.||:|..:.|||.     |...::.|    
Mouse  2195 YFLFLFYYMVVQGKLMRKQKWG---YFCSKWNLLEVAIILASWSALVV-----FVKRTILADRDL 2251

  Fly   654 ---RAHSDVTYQSLDVLCFWNIIYVD-----MMAILAFLVWIKIFKFISFNKTLVQFTTTLKRCS 710
               |.|.|      :.:.|......|     ::|.|..|..:|::..:..|..:...|:.|:|..
Mouse  2252 QRYREHRD------EGISFSETAAADAALGYIIAFLVLLSTVKLWHLLRLNPKMNMITSALRRAW 2310

  Fly   711 KDLAGFSLMFGIVFLAYAQLGLLLFGTKHPDFRNFITSILTMIRMILGDFQYNLIEQANRVLGPI 775
            .|::||..:..|:.|||:....|:||.|...::....:..||:.:.||.|.|..:...:.:||.:
Mouse  2311 GDISGFVAVILIMLLAYSFASNLVFGWKLRSYKTLFDAAETMVSLQLGIFNYEEVLDYSPILGSL 2375

  Fly   776 YFLTYILLVFFILLNMFLAIIMETYN 801
            ...:.|:.:.|::||:|:::|:..::
Mouse  2376 LIGSCIVFMTFVVLNLFISVILVAFS 2401

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pkd2NP_609561.2 PKD_channel 402..803 CDD:285288 105/430 (24%)
Pkd1l2NP_083962.4 CLECT 37..153 CDD:153057
Gal_Lectin 168..250 CDD:280328
REJ 492..864 CDD:280229
GPS 1280..1319 CDD:280071
PLAT_polycystin 1390..1509 CDD:238850
PKD_channel 1980..2402 CDD:285288 115/557 (21%)
Interaction with GNAS and GNAI1. {ECO:0000250} 2381..2461 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121705074
eggNOG 1 0.900 E1_KOG3599
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.