DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkd2 and PKD1

DIOPT Version :8

Sequence 1:NP_609561.2 Gene:Pkd2 / 34651 FlyBaseID:FBgn0041195 Length:924 Species:Drosophila melanogaster
Sequence 2:XP_024306066.1 Gene:PKD1 / 5310 HGNCID:9008 Length:4343 Species:Homo sapiens

Alignment Length:547 Identity:116/548 (21%)
Similarity:200/548 (36%) Gaps:115/548 (21%)


  Fly   435 LGPPRLRQIRVRKESCYVNDAFIRYFNTCYAA-------YSSGAEDRKPMHKGS-------PFRT 485
            ||||||||:|: :|:.|.:....| .:||.||       |..|.|.   .|.||       |   
Human  3784 LGPPRLRQVRL-QEALYPDPPGPR-VHTCSAAGGFSTSDYDVGWES---PHNGSGTWAYSAP--- 3840

  Fly   486 MHDLDSTPIWTVLAFYRTGGYT----VNLDYDKDRNVKIINDLKDIHWLDRGSRLCLVEFNLFNE 546
              ||.....|...|.|.:|||.    ::|:..:||    :..|:..:|||..||...:|...::.
Human  3841 --DLLGAWSWGSCAVYDSGGYVQELGLSLEESRDR----LRFLQLHNWLDNRSRAVFLELTRYSP 3899

  Fly   547 NTDIFQSIKLIAEIPPTGGVIPQAHLQTVKMYSFFTDRSM-LMTVIYIFWYIMVIYYTIYEITEI 610
            ...:..::.|..|.|..|..:....::...:.......|: |:|.:.:.  :..:::.:.|....
Human  3900 AVGLHAAVTLRLEFPAAGRALAALSVRPFALRRLSAGLSLPLLTSVCLL--LFAVHFAVAEARTW 3962

  Fly   611 RKSGIKIYFCSMLNILDCAILLGCYLALVYNIWHSFKVMSLTA-----------RAHSDVT---- 660
            .:.                   |.:..|....|..:.:::|||           .|....|    
Human  3963 HRE-------------------GRWRVLRLGAWARWLLVALTAATALVRLAQLGAADRQWTRFVR 4008

  Fly   661 -----YQSLDVLCFWNIIYVDMMAILAFLVWIKIFKFISFNKTLVQFTTTLKRCSKDLAGFSLMF 720
                 :.|.|.:...:.....:.|.|.||:.:|..:.:.|.:....|..||.|...:|.|.:|..
Human  4009 GRPRRFTSFDQVAQLSSAARGLAASLLFLLLVKAAQQLRFVRQWSVFGKTLCRALPELLGVTLGL 4073

  Fly   721 GIVFLAYAQLGLLLFGTKHPDFRNFITSILTMIRMIL----GDFQYNLIEQANRVLGPIYFLTYI 781
            .::.:|||||.:||..       :.:.|:.::.:.:|    |.....|....:..|.|:..:...
Human  4074 VVLGVAYAQLAILLVS-------SCVDSLWSVAQALLVLCPGTGLSTLCPAESWHLSPLLCVGLW 4131

  Fly   782 LLVFFILLNMFLAIIMETYNTVKGEITQGRSHLGSY--IYRKLSGMLYWITHCGRKRRHH----- 839
            .|..:..|.:...|:...|:.::||:.:.......|  :...|..:..|:.....|...|     
Human  4132 ALRLWGALRLGAVILRWRYHALRGELYRPAWEPQDYEMVELFLRRLRLWMGLSKVKEFRHKVRFE 4196

  Fly   840 -----PQASETEDKDAEHDV---GAAHDETHEIRKNMTPAEQQYFKDIPQGENQDMVRLNNRV-- 894
                 |..|....| ...||   .|..|.:|.    .|.:.|.      .|.:..:.||..|.  
Human  4197 GMEPLPSRSSRGSK-VSPDVPPPSAGSDASHP----STSSSQL------DGLSVSLGRLGTRCEP 4250

  Fly   895 --GLLEEILEKLINNMDDILKRVEKDY 919
              ..|:.:.|.|:...|.:.:..|..|
Human  4251 EPSRLQAVFEALLTQFDRLNQATEDVY 4277

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pkd2NP_609561.2 PKD_channel 402..803 CDD:285288 89/411 (22%)
PKD1XP_024306066.1 LRR <50..>126 CDD:227223
leucine-rich repeat 70..92 CDD:275378
leucine-rich repeat 93..116 CDD:275378
PCC 97..2768 CDD:188093
leucine-rich repeat 117..129 CDD:275378
GPS 3051..3100 CDD:197639
PLAT_polycystin 3158..3277 CDD:238850
PKD_channel 3751..4153 CDD:332708 89/411 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3599
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.